BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j23 (327 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 27 4.8 SB_7410| Best HMM Match : 7tm_1 (HMM E-Value=2.4e-22) 26 6.3 SB_20218| Best HMM Match : Xan_ur_permease (HMM E-Value=0.035) 26 8.3 >SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 794 Score = 26.6 bits (56), Expect = 4.8 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -1 Query: 327 FFFYTYFLFTQNITIALNTDGCHRRHPRRYVSEFNISS 214 FF FLF ++ T N GC +R R S F + + Sbjct: 2 FFTSDQFLFAKSETRVANAYGCQQRSVVRAASTFRVKN 39 >SB_7410| Best HMM Match : 7tm_1 (HMM E-Value=2.4e-22) Length = 341 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 196 PFTRAARRYVKFGNISTRVSSMTTIS 273 PF+ AA +Y+ + I+ V SM TIS Sbjct: 90 PFSYAACQYMGYSGIAIAVGSMQTIS 115 >SB_20218| Best HMM Match : Xan_ur_permease (HMM E-Value=0.035) Length = 242 Score = 25.8 bits (54), Expect = 8.3 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 261 HRRHPRRYVSEFNISSCSTCKW--*CTESRGRSMGRSKNRRVLHTYSYRDRS 112 H R PR Y ISS C W C RS S + T S R RS Sbjct: 5 HARDPRCYNGRVPISSPYRCDWPNGCVTEVHRSRCHSAHHHADWTCSLRGRS 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,230,637 Number of Sequences: 59808 Number of extensions: 92745 Number of successful extensions: 220 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 220 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 450550116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -