BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j22 (401 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11990.1 68418.m01402 proline-rich family protein contains pr... 32 0.16 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 31 0.38 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 29 1.2 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 28 2.7 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 27 4.7 At1g23540.1 68414.m02960 protein kinase family protein contains ... 27 4.7 At4g27110.1 68417.m03896 phytochelatin synthetase-related contai... 27 6.2 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 27 6.2 At5g50910.1 68418.m06312 hypothetical protein 26 8.2 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 26 8.2 At4g24690.1 68417.m03534 ubiquitin-associated (UBA)/TS-N domain-... 26 8.2 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 26 8.2 At1g34245.1 68414.m04250 expressed protein 26 8.2 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 31.9 bits (69), Expect = 0.16 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +2 Query: 74 CPPVCSPPDCRP---ICGPASPLLCQSSVPP 157 CP +CSPP +P + P SP L SS PP Sbjct: 38 CPTICSPPPSKPSPSMSPPPSPSLPLSSSPP 68 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 30.7 bits (66), Expect = 0.38 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 71 YCPPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNPCIN 193 YCPP PP C IC P P PPT + P N Sbjct: 29 YCPP---PPPCICICNPGPPPPQPDPQPPTPPTFQPAPPAN 66 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 29.1 bits (62), Expect = 1.2 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +2 Query: 71 YCPPVCSPP--DCRPICGPASP 130 +CP C C+PICGP SP Sbjct: 35 FCPDSCHVECASCKPICGPPSP 56 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 27.9 bits (59), Expect = 2.7 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 77 PPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNP 184 PPV SPP P+ P P S PP + +P Sbjct: 431 PPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSP 466 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 27.1 bits (57), Expect = 4.7 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +2 Query: 77 PPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNPCINIYS 202 PPV SPP PI P P + S PP Y P +YS Sbjct: 496 PPVHSPPPPSPIHSPPPPPV--YSPPPPPPVYSPPPPPPVYS 535 Score = 26.6 bits (56), Expect = 6.2 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 77 PPVCSPPDCRPICGPASPLLCQSSVPP 157 PPV SPP P+ P P S PP Sbjct: 522 PPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 77 PPVCSPPDCRPICGPASPLLCQSSVPP 157 PPV SPP P+ P P S PP Sbjct: 513 PPVYSPPPPPPVYSPPPPPPVYSPPPP 539 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 27.1 bits (57), Expect = 4.7 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +2 Query: 77 PPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNPCI 190 PPV S P P ++P L + S PP P P I Sbjct: 33 PPVDSSPPSPPADSSSTPPLSEPSTPPPDSQLPPLPSI 70 >At4g27110.1 68417.m03896 phytochelatin synthetase-related contains Pfam PF04833: Phytochelatin synthetase-like conserved region Length = 668 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 209 CNSCIC*CKDLQDSTVVLVAR 147 CN+C C CKD+ T AR Sbjct: 438 CNTCACGCKDIDTDTCNANAR 458 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 26.6 bits (56), Expect = 6.2 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 77 PPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNPCIN 193 PPV SPP PI P P+ P T +P N Sbjct: 797 PPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMAN 835 >At5g50910.1 68418.m06312 hypothetical protein Length = 116 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 181 SLHQHIQLLHSNYV-TQWTISIVNLKMVRNTHLFCKMYS 294 S HI + + ++ QWT VNL + + H+F Y+ Sbjct: 3 SFSWHIIVSANGFILNQWTTHFVNLMHIISPHMFISKYT 41 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 77 PPVCSPPDCRPICGPASPLLCQSSVPPTQ 163 PPV SPP P+ P P+ S PP+Q Sbjct: 607 PPVHSPPPPPPVYSPPPPVF---SPPPSQ 632 >At4g24690.1 68417.m03534 ubiquitin-associated (UBA)/TS-N domain-containing protein / octicosapeptide/Phox/Bemp1 (PB1) domain-containing protein contains Pfam profiles PF00627: Ubiquitin-associated (UBA)/TS-N domain, PF00569: Zinc finger ZZ type domain, PF00564: PB1 domain Length = 704 Score = 26.2 bits (55), Expect = 8.2 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -1 Query: 131 AEMQVHRSDDNPEVNRLVDNNPFFTFLIYRLVNLKNFTNISI 6 AE+ + SD++ +V LVD+N F RL LK N + Sbjct: 52 AELSLTYSDEDGDVVALVDDNDLFDVTNQRLKFLKINVNAGV 93 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 26.2 bits (55), Expect = 8.2 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 74 CPPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNP 184 CPP SPP C P P P +PP + P P Sbjct: 70 CPPPPSPPPCPPPPSP-PPSPPPPQLPPPPQLPPPAP 105 >At1g34245.1 68414.m04250 expressed protein Length = 120 Score = 26.2 bits (55), Expect = 8.2 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = +2 Query: 62 KMGYCPPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNPCINIYSC 205 +M P S PDC CG SP C+ V + C C IY C Sbjct: 63 EMEMYPTGSSLPDCSYACGACSP--CK-RVMISFECSVAESCSVIYRC 107 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,605,733 Number of Sequences: 28952 Number of extensions: 135617 Number of successful extensions: 435 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 585758608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -