BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j20 (319 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 24 1.2 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 2.1 CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal pe... 22 4.8 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 22 6.4 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 21 8.4 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 21 8.4 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 74 CPPVCSPPDCRPICGPAS 127 C CSP C P C P S Sbjct: 150 CLSKCSPTKCVPFCRPFS 167 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/36 (36%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 74 CPPV--CSPPDCRPICGPASPLLCQSSV-PPTQRCY 172 C P C P + CGP L C +V RCY Sbjct: 49 CVPTKECPPDEVFKCCGPCYQLNCYGTVLDCAGRCY 84 >CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal peptidase protein. Length = 247 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +2 Query: 158 TQRCYPVNPCINIYSCYTQIM 220 T+ + +NP N Y+ YT ++ Sbjct: 94 TRASFNLNPLSNTYTIYTSVL 114 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 71 YCPPVCSPPDCRPICGPASPLLCQSSV 151 + PVC PPD P P SP L ++V Sbjct: 238 FVSPVCLPPDDFP---PTSPGLNVTAV 261 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 125 SPLLCQSSVPPTQ 163 SPL C+ SVP Q Sbjct: 804 SPLYCEGSVPTLQ 816 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = +3 Query: 204 VTLKLCNAMDDFYSE 248 V L+LCN + D++++ Sbjct: 596 VPLQLCNILQDYFTD 610 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 341,926 Number of Sequences: 2352 Number of extensions: 7740 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 21181083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -