BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j19 (672 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 2.3 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 3.0 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +3 Query: 189 DKVFEVMRQCCIKHKPRSLVCEGYDLEPRQFAPVTDRP 302 D V ++ + P L+ + D++P+QF +RP Sbjct: 522 DHVISLIDEISYMAPPAPLISQYDDIDPQQFCNGDNRP 559 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 472 ARPYEDIVDRLREEYSEGKGSKSYLKGLRILIN 374 A+P ++ D R+ Y K GLR+L++ Sbjct: 67 AQPLNELFDVTRDNYRHITELKRRFPGLRVLLS 99 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,903 Number of Sequences: 336 Number of extensions: 3339 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -