BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j13 (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.6 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 22 4.6 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 621 PVVGHPNGLRSESRSTYSCSMP-NHGSWS 538 P VGHP + SRS S SMP +G +S Sbjct: 1761 PPVGHPTNASAHSRSG-SQSMPRQNGRYS 1788 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 22.2 bits (45), Expect = 4.6 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +1 Query: 364 RPDDKH-ELRHAPEAPGHIQGPVPARKPRACHVRHIRLQHATNKDKPPY*MPRSVRP 531 +P H LR PEA PV +PR H R R A + P +P+ P Sbjct: 108 QPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPP 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,029 Number of Sequences: 438 Number of extensions: 4406 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -