BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j12 (261 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 20 4.4 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 20 4.4 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 20 5.8 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 20 5.8 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 20.2 bits (40), Expect = 4.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 177 RYVSEFNISSCST 139 RYV E N+++C T Sbjct: 192 RYVPEGNMTACGT 204 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 20.2 bits (40), Expect = 4.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 177 RYVSEFNISSCST 139 RYV E N+++C T Sbjct: 68 RYVPEGNMTACGT 80 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 19.8 bits (39), Expect = 5.8 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = -1 Query: 261 FFFYTYFLFTQNITIALNTDGCHRRHPRRYV 169 +F F+ ++ + + H R P RYV Sbjct: 328 YFNCIMFMVASSVVLTVLVLNFHHRTPDRYV 358 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 19.8 bits (39), Expect = 5.8 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = -1 Query: 261 FFFYTYFLFTQNITIALNTDGCHRRHPRRYV 169 +F F+ ++ + + H R P RYV Sbjct: 328 YFNCIMFMVASSVVLTVLVLNFHHRTPDRYV 358 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,958 Number of Sequences: 438 Number of extensions: 822 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 48 effective length of database: 125,319 effective search space used: 4762122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits)
- SilkBase 1999-2023 -