BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j11 (675 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 2.3 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 5.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.3 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 121 NIVLVCLRVDSAHFGFLIVLCVFNGWLL 38 N+ L CL V +H V+C W + Sbjct: 8 NLALFCLHVQHSHGATDKVICYVASWAI 35 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/41 (24%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 463 SRHRWNKHNSQRERGKFGFRCKNAKHRRPRGEAS-SGIQHG 582 S + W K+N R R + R + + G+Q G Sbjct: 384 SNNHWRKNNPNDNRNNTSSRAQGETSRNSKNSGNGGGVQDG 424 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 296 FHATDFEDVIVRAH 337 F DFE++IV+AH Sbjct: 1434 FAVLDFENLIVKAH 1447 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,524 Number of Sequences: 336 Number of extensions: 3964 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -