BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j10 (597 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr ... 26 4.8 SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2... 26 4.8 SPBC1604.08c |imp1||importin alpha|Schizosaccharomyces pombe|chr... 25 6.3 SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|... 25 8.4 SPBC23E6.03c |nta1||protein N-terminal amidase Nta1 |Schizosacch... 25 8.4 >SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -1 Query: 537 PANVQALLDTILFTIA 490 PAN+QALL+ I+F IA Sbjct: 517 PANLQALLNRIIFIIA 532 >SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2|||Manual Length = 479 Score = 25.8 bits (54), Expect = 4.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -1 Query: 318 VLPHRRRCQPKRGRSGIREGQWFDATTSR 232 V PH+RR +R R F ATT R Sbjct: 44 VTPHKRRALARRNSLARRRSNVFSATTPR 72 >SPBC1604.08c |imp1||importin alpha|Schizosaccharomyces pombe|chr 2|||Manual Length = 539 Score = 25.4 bits (53), Expect = 6.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -2 Query: 269 FVKGNGLMQPLPGLVQGINSITNSQTITAVTWHSSS 162 +V GNG++QPL ++Q +S ++ + TW S+ Sbjct: 199 YVLGNGVLQPLLNILQ--SSASDVSMLRNATWTLSN 232 >SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 612 Score = 25.0 bits (52), Expect = 8.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 432 RKVPVYLFRDINETSERW 485 R++P YL D NE+S W Sbjct: 274 RRIPSYLANDANESSTIW 291 >SPBC23E6.03c |nta1||protein N-terminal amidase Nta1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 286 Score = 25.0 bits (52), Expect = 8.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 227 PNLEVVASNHCPS 265 P LE V SNHCPS Sbjct: 59 PFLENVTSNHCPS 71 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,385,509 Number of Sequences: 5004 Number of extensions: 47647 Number of successful extensions: 106 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -