BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j10 (597 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical pr... 27 7.7 AL023856-8|CAA19565.2| 326|Caenorhabditis elegans Hypothetical ... 27 7.7 >U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical protein T12A2.15a protein. Length = 713 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 260 GNGLMQPLPGLVQGINSITNSQ 195 G G M LPGL+ I S+ NSQ Sbjct: 224 GMGEMVELPGLIDAIRSVINSQ 245 >AL023856-8|CAA19565.2| 326|Caenorhabditis elegans Hypothetical protein Y94A7B.3 protein. Length = 326 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 4 FVVYPALVRSTRDVHKLFLLFYKFINLIIKLVFRT 108 F VYP ++ H++F+L F +LII+ F T Sbjct: 164 FKVYPRILLYDTAEHRIFILAIDFYSLIIRQSFFT 198 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,301,366 Number of Sequences: 27780 Number of extensions: 275469 Number of successful extensions: 599 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -