BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j09 (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizo... 29 0.87 SPBC3H7.09 |mug142||palmitoyltransferase|Schizosaccharomyces pom... 27 2.6 >SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizosaccharomyces pombe|chr 1|||Manual Length = 722 Score = 28.7 bits (61), Expect = 0.87 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -2 Query: 250 VVIPNDNNEIVNPLNFSNC 194 V +PN+NN+++ PL+ +C Sbjct: 137 VTLPNENNQVIEPLSSQSC 155 >SPBC3H7.09 |mug142||palmitoyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 27.1 bits (57), Expect = 2.6 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -3 Query: 543 QIRTHLISKPTIIL--ILFFFYSTFILFSKRVHQI*VTVEYIYA 418 Q + LIS +IL +LFF +S F L+ + +T Y+YA Sbjct: 83 QYKAFLISLFALILPGVLFFIFSAFWLWHHVSPAVPITFAYLYA 126 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,968,183 Number of Sequences: 5004 Number of extensions: 64076 Number of successful extensions: 140 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -