SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte10j07
         (637 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0320 + 20181560-20182063,20182513-20182853,20183159-201838...    27   9.4  

>05_04_0320 +
           20181560-20182063,20182513-20182853,20183159-20183819,
           20183954-20184112
          Length = 554

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
 Frame = -1

Query: 427 ILGVCSLGSFSFDT-LSLSCSIVADVAGFMNLSEILLPYT 311
           I G C LG     T     C++  D+ G +NL  +  PYT
Sbjct: 193 ISGRCLLGKEVMGTKFDEVCNLFRDIEGGVNLMSVFFPYT 232


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,807,827
Number of Sequences: 37544
Number of extensions: 212627
Number of successful extensions: 435
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 433
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 435
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1561213104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -