BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j07 (637 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0320 + 20181560-20182063,20182513-20182853,20183159-201838... 27 9.4 >05_04_0320 + 20181560-20182063,20182513-20182853,20183159-20183819, 20183954-20184112 Length = 554 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -1 Query: 427 ILGVCSLGSFSFDT-LSLSCSIVADVAGFMNLSEILLPYT 311 I G C LG T C++ D+ G +NL + PYT Sbjct: 193 ISGRCLLGKEVMGTKFDEVCNLFRDIEGGVNLMSVFFPYT 232 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,807,827 Number of Sequences: 37544 Number of extensions: 212627 Number of successful extensions: 435 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 435 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -