BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j07 (637 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF272893-1|AAK13257.1| 441|Homo sapiens UBX domain-containing p... 35 0.28 >AF272893-1|AAK13257.1| 441|Homo sapiens UBX domain-containing protein 1 protein. Length = 441 Score = 34.7 bits (76), Expect = 0.28 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 496 GRGHKLTESTTSSHDSVKKDVPVVK--RSGLSEESKVAAEAALARLNQK 636 G G KL ES K + P + R G + E+++AA AALARL QK Sbjct: 18 GPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAAAAALARLEQK 66 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,791,286 Number of Sequences: 237096 Number of extensions: 1218868 Number of successful extensions: 5816 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5816 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6972732040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -