BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j03 (524 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 34 0.062 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 31 0.77 SB_58611| Best HMM Match : Collagen (HMM E-Value=0.4) 29 3.1 SB_18162| Best HMM Match : E-MAP-115 (HMM E-Value=0.21) 28 4.1 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) 27 7.2 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_7620| Best HMM Match : Remorin_N (HMM E-Value=5.2) 27 9.5 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 34.3 bits (75), Expect = 0.062 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -2 Query: 493 ENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATTRSEAQRAL 344 E EK+ + EL+ S HF E ++R RA+ED+ +SE ++ L Sbjct: 332 EEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKEL 381 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 30.7 bits (66), Expect = 0.77 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 387 KTAVPRRGAKLNARSTSILVRGASLGNGDSVTSNAHRSSH 268 KTAVPRRG K S++ R + + + +TS HR H Sbjct: 112 KTAVPRRGVK-GLPLNSVIRRLVDVHSSEGMTSARHRKRH 150 >SB_58611| Best HMM Match : Collagen (HMM E-Value=0.4) Length = 773 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -1 Query: 380 RCH--DAERSSTRALRPYSSEERRSGTETA*LQTPIAVLIWVWRLT 249 RC+ DA+ S+ A ++ G + L P A ++WVWR T Sbjct: 442 RCYTKDADASTILAASKRPTQLHPDGPDPETLLPPSATVLWVWRTT 487 >SB_18162| Best HMM Match : E-MAP-115 (HMM E-Value=0.21) Length = 659 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -1 Query: 380 RCH--DAERSSTRALRPYSSEERRSGTETA*LQTPIAVLIWVWRLTDHLTTASNGSDSSS 207 RC+ DA+ S+ A ++ G + L P A + WVWR T T G D SS Sbjct: 365 RCYTKDADASTISAASKRPTQLHPDGPDPETLLPPSATVSWVWRTTKCQTV---GKDVSS 421 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -1 Query: 452 SGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRS 312 S +SP+ P RTT S ++S + R++ R +SS +RR+ Sbjct: 155 SSKSPSPPTNRTTQGESPKTSSSGHGQHSSRTAVRRSASFSSSQRRT 201 >SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 367 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 480 A+W G E WRL + G++ W L ++ S G Sbjct: 62 ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 99 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 367 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 480 A+W G E WRL + G++ W L ++ S G Sbjct: 78 ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 115 >SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) Length = 259 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 257 RLTDHLTTASNGSDSSSRGTEYST 186 RLT++ +ASNGSD + E ST Sbjct: 2 RLTNYTLSASNGSDDETSNKEVST 25 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -1 Query: 455 LSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRSGTET 300 +S QSPT P + + S C +R R P EER+ TET Sbjct: 338 VSPQSPTQPQYYNKSTSFFDSI---SCEANDRDKNRKAHPSWQEERKLNTET 386 >SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 360 SLRVVAPRSSRALEAVRCRGSDVGKCRRLAA*YCNSLFERC 482 ++RV+APR + A E S+ C R AA + E C Sbjct: 57 NIRVIAPRKATASELAAFHSSEYVNCMRRAAEAVSDGSEEC 97 >SB_7620| Best HMM Match : Remorin_N (HMM E-Value=5.2) Length = 330 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -1 Query: 380 RCH--DAERSSTRALRPYSSEERRSGTETA*LQTPIAVLIWVWRLT 249 RC+ DA+ S+ A ++ G + L P A + WVWR T Sbjct: 206 RCYTKDADASTILAASKRPTQLHPDGPDPETLLPPSATVSWVWRTT 251 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,565,331 Number of Sequences: 59808 Number of extensions: 282878 Number of successful extensions: 876 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -