BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j02 (449 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L47738-1|AAA79022.1| 236|Homo sapiens protein ( Homo sapiens in... 34 0.19 X62009-1|CAB56757.1| 754|Homo sapiens fibrillin 5 protein. 32 1.0 U03272-1|AAA18950.1| 2911|Homo sapiens fibrillin-2 protein. 32 1.0 AB209735-1|BAD92972.1| 1976|Homo sapiens fibrillin 2 (congenital... 32 1.0 X63556-1|CAA45118.1| 3002|Homo sapiens fibrillin protein. 31 2.4 X62008-1|CAB56534.1| 517|Homo sapiens fibrillin 15 protein. 31 2.4 L13923-1|AAB02036.1| 2871|Homo sapiens fibrillin protein. 31 2.4 BC008761-1|AAH08761.2| 743|Homo sapiens LTBP3 protein protein. 31 2.4 AY165865-1|AAO18147.1| 2809|Homo sapiens fibrillin-3 short form ... 31 2.4 AY165864-1|AAO18146.1| 2809|Homo sapiens fibrillin-3 short form ... 31 2.4 AY165863-1|AAO18145.1| 2809|Homo sapiens fibrillin-3 short form ... 31 2.4 AL117551-1|CAB55988.1| 511|Homo sapiens hypothetical protein pr... 31 2.4 AK024477-1|BAB15767.1| 1382|Homo sapiens FLJ00070 protein protein. 31 2.4 AF135960-1|AAF62352.3| 1256|Homo sapiens latent transforming gro... 31 2.4 AB177803-1|BAD16739.1| 2871|Homo sapiens fibrillin 1 protein. 31 2.4 AB177802-1|BAD16738.1| 1365|Homo sapiens fibrillin 1 protein. 31 2.4 AB177800-1|BAD16736.1| 2809|Homo sapiens fibrillin 3 protein. 31 2.4 AB177799-1|BAD16735.1| 2809|Homo sapiens fibrillin 3 protein. 31 2.4 AB177798-1|BAD16734.1| 2809|Homo sapiens fibrillin 3 protein. 31 2.4 AB177797-1|BAD16733.1| 2809|Homo sapiens fibrillin 3 protein. 31 2.4 AB053450-1|BAB47408.2| 2816|Homo sapiens fibrillin3 protein. 31 2.4 U33837-1|AAB41649.1| 4655|Homo sapiens gp330 precursor protein. 29 7.3 AY265358-1|AAP88586.1| 4655|Homo sapiens glycoprotein receptor g... 29 7.3 AY265357-1|AAP88585.1| 4655|Homo sapiens glycoprotein receptor g... 29 7.3 AC008178-1|AAY24266.1| 773|Homo sapiens unknown protein. 29 7.3 >L47738-1|AAA79022.1| 236|Homo sapiens protein ( Homo sapiens inducible protein mRNA, complete cds. ). Length = 236 Score = 34.3 bits (75), Expect = 0.19 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 15 LRVTRTTSQWICRRIVLSTFDASVSHKM*CEH 110 L + R T + +C+ + L +FDA +H++ C+H Sbjct: 86 LEINRVTHRLLCKHMTLDSFDAMFTHRLLCKH 117 >X62009-1|CAB56757.1| 754|Homo sapiens fibrillin 5 protein. Length = 754 Score = 31.9 bits (69), Expect = 1.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G +C CN LD E C D+D C++ Sbjct: 340 TIGSFKCRCNSGFALDMEERNCTDIDECRI 369 >U03272-1|AAA18950.1| 2911|Homo sapiens fibrillin-2 protein. Length = 2911 Score = 31.9 bits (69), Expect = 1.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G +C CN LD E C D+D C++ Sbjct: 1091 TIGSFKCRCNSGFALDMEERNCTDIDECRI 1120 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQLK 252 T G +C C VL E+ C DLD CQ K Sbjct: 2508 TEGSYQCSCPRGYVLQEDGKTCKDLDECQTK 2538 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDAC 243 T G +C+C L E+T +C D+D C Sbjct: 1668 TFGSFQCECPQGYYLSEDTRICEDIDEC 1695 Score = 28.7 bits (61), Expect = 9.7 Identities = 21/59 (35%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +1 Query: 85 YHTRCDANTI--SQRTCDNPQIYEMGYTCGWSRCDCNGDLVLDEETGLCVDLDACQLKN 255 + TR D N S C N Q T G RC+C LD CVD D C + N Sbjct: 2165 HDTREDVNECLESPGICSNGQCIN---TDGSFRCECPMGYNLDYTGVRCVDTDECSIGN 2220 >AB209735-1|BAD92972.1| 1976|Homo sapiens fibrillin 2 (congenital contractural arachnodactyly) variant protein. Length = 1976 Score = 31.9 bits (69), Expect = 1.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G +C CN LD E C D+D C++ Sbjct: 156 TIGSFKCRCNSGFALDMEERNCTDIDECRI 185 Score = 30.3 bits (65), Expect = 3.2 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQLK 252 T G +C C VL E+ C DLD CQ K Sbjct: 1573 TEGSYQCSCPRGYVLQEDGKTCKDLDECQTK 1603 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDAC 243 T G +C+C L E+T +C D+D C Sbjct: 733 TFGSFQCECPQGYYLSEDTRICEDIDEC 760 Score = 28.7 bits (61), Expect = 9.7 Identities = 21/59 (35%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +1 Query: 85 YHTRCDANTI--SQRTCDNPQIYEMGYTCGWSRCDCNGDLVLDEETGLCVDLDACQLKN 255 + TR D N S C N Q T G RC+C LD CVD D C + N Sbjct: 1230 HDTREDVNECLESPGICSNGQCIN---TDGSFRCECPMGYNLDYTGVRCVDTDECSIGN 1285 >X63556-1|CAA45118.1| 3002|Homo sapiens fibrillin protein. Length = 3002 Score = 30.7 bits (66), Expect = 2.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G +C C+ LD E C D+D C++ Sbjct: 1178 TIGSFKCRCDSGFALDSEERNCTDIDECRI 1207 Score = 29.9 bits (64), Expect = 4.2 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +1 Query: 64 CPRLMHPYHTRCDAN---TISQRTCDNPQIYEMGYTCGWSRCDCNGDLVLDEETGLCVDL 234 CP +HT C N T C + I + T G C+C LD+ C D+ Sbjct: 2642 CPPGFTQHHTSCIDNNECTSDINLCGSKGICQN--TPGSFTCECQRGFSLDQTGSSCEDV 2699 Query: 235 DACQ 246 D C+ Sbjct: 2700 DECE 2703 Score = 29.1 bits (62), Expect = 7.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDACQLKNV 258 G RC+C+ V + C D+D C L N+ Sbjct: 1556 GGYRCECDMGFVPSADGKACEDIDECSLPNI 1586 >X62008-1|CAB56534.1| 517|Homo sapiens fibrillin 15 protein. Length = 517 Score = 30.7 bits (66), Expect = 2.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G +C C+ LD E C D+D C++ Sbjct: 251 TIGSFKCRCDSGFALDSEERNCTDIDECRI 280 >L13923-1|AAB02036.1| 2871|Homo sapiens fibrillin protein. Length = 2871 Score = 30.7 bits (66), Expect = 2.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G +C C+ LD E C D+D C++ Sbjct: 1047 TIGSFKCRCDSGFALDSEERNCTDIDECRI 1076 Score = 29.9 bits (64), Expect = 4.2 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +1 Query: 64 CPRLMHPYHTRCDAN---TISQRTCDNPQIYEMGYTCGWSRCDCNGDLVLDEETGLCVDL 234 CP +HT C N T C + I + T G C+C LD+ C D+ Sbjct: 2511 CPPGFTQHHTSCIDNNECTSDINLCGSKGICQN--TPGSFTCECQRGFSLDQTGSSCEDV 2568 Query: 235 DACQ 246 D C+ Sbjct: 2569 DECE 2572 Score = 29.1 bits (62), Expect = 7.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDACQLKNV 258 G RC+C+ V + C D+D C L N+ Sbjct: 1425 GGYRCECDMGFVPSADGKACEDIDECSLPNI 1455 >BC008761-1|AAH08761.2| 743|Homo sapiens LTBP3 protein protein. Length = 743 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDACQLKN 255 G + C+C G LD CVD+D C+ N Sbjct: 673 GGAVCECPGGFQLDASRARCVDIDECRELN 702 >AY165865-1|AAO18147.1| 2809|Homo sapiens fibrillin-3 short form precursor transcript variant 3 protein. Length = 2809 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDAC 243 G RC CNG LD G C D++ C Sbjct: 1424 GMFRCICNGGYELDRGGGNCTDINEC 1449 Score = 29.5 bits (63), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVD--LDACQLK 252 T G RC+C L+LD LCVD L+ C L+ Sbjct: 888 TAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR 920 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G C C G LD + C D+D C++ Sbjct: 1005 TVGSFHCACAGGFALDAQERNCTDIDECRI 1034 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 130 DNPQIYEMGYTC---GWSRCDCNGDLVLDEETGLCVDLDACQL 249 +NP++ + G+ G RC C + + CVD+D C L Sbjct: 1202 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDL 1244 >AY165864-1|AAO18146.1| 2809|Homo sapiens fibrillin-3 short form precursor transcript variant 2 protein. Length = 2809 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDAC 243 G RC CNG LD G C D++ C Sbjct: 1424 GMFRCICNGGYELDRGGGNCTDINEC 1449 Score = 29.5 bits (63), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVD--LDACQLK 252 T G RC+C L+LD LCVD L+ C L+ Sbjct: 888 TAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR 920 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G C C G LD + C D+D C++ Sbjct: 1005 TVGSFHCACAGGFALDAQERNCTDIDECRI 1034 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 130 DNPQIYEMGYTC---GWSRCDCNGDLVLDEETGLCVDLDACQL 249 +NP++ + G+ G RC C + + CVD+D C L Sbjct: 1202 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDL 1244 >AY165863-1|AAO18145.1| 2809|Homo sapiens fibrillin-3 short form precursor transcript variant 1 protein. Length = 2809 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDAC 243 G RC CNG LD G C D++ C Sbjct: 1424 GMFRCICNGGYELDRGGGNCTDINEC 1449 Score = 29.5 bits (63), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVD--LDACQLK 252 T G RC+C L+LD LCVD L+ C L+ Sbjct: 888 TAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR 920 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G C C G LD + C D+D C++ Sbjct: 1005 TVGSFHCACAGGFALDAQERNCTDIDECRI 1034 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 130 DNPQIYEMGYTC---GWSRCDCNGDLVLDEETGLCVDLDACQL 249 +NP++ + G+ G RC C + + CVD+D C L Sbjct: 1202 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDL 1244 >AL117551-1|CAB55988.1| 511|Homo sapiens hypothetical protein protein. Length = 511 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDACQLKN 255 G + C+C G LD CVD+D C+ N Sbjct: 441 GGAVCECPGGFQLDASRARCVDIDECRELN 470 >AK024477-1|BAB15767.1| 1382|Homo sapiens FLJ00070 protein protein. Length = 1382 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDACQLKN 255 G + C+C G LD CVD+D C+ N Sbjct: 1312 GGAVCECPGGFQLDASRARCVDIDECRELN 1341 >AF135960-1|AAF62352.3| 1256|Homo sapiens latent transforming growth factor beta binding protein 3 protein. Length = 1256 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDACQLKN 255 G + C+C G LD CVD+D C+ N Sbjct: 1186 GGAVCECPGGFQLDASRARCVDIDECRELN 1215 >AB177803-1|BAD16739.1| 2871|Homo sapiens fibrillin 1 protein. Length = 2871 Score = 30.7 bits (66), Expect = 2.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G +C C+ LD E C D+D C++ Sbjct: 1047 TIGSFKCRCDSGFALDSEERNCTDIDECRI 1076 Score = 29.9 bits (64), Expect = 4.2 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +1 Query: 64 CPRLMHPYHTRCDAN---TISQRTCDNPQIYEMGYTCGWSRCDCNGDLVLDEETGLCVDL 234 CP +HT C N T C + I + T G C+C LD+ C D+ Sbjct: 2511 CPPGFTQHHTSCIDNNECTSDINLCGSKGICQN--TPGSFTCECQRGFSLDQTGSSCEDV 2568 Query: 235 DACQ 246 D C+ Sbjct: 2569 DECE 2572 Score = 29.1 bits (62), Expect = 7.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDACQLKNV 258 G RC+C+ V + C D+D C L N+ Sbjct: 1425 GGYRCECDMGFVPSADGKACEDIDECSLPNI 1455 >AB177802-1|BAD16738.1| 1365|Homo sapiens fibrillin 1 protein. Length = 1365 Score = 30.7 bits (66), Expect = 2.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G +C C+ LD E C D+D C++ Sbjct: 1047 TIGSFKCRCDSGFALDSEERNCTDIDECRI 1076 >AB177800-1|BAD16736.1| 2809|Homo sapiens fibrillin 3 protein. Length = 2809 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDAC 243 G RC CNG LD G C D++ C Sbjct: 1424 GMFRCICNGGYELDRGGGNCTDINEC 1449 Score = 29.5 bits (63), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVD--LDACQLK 252 T G RC+C L+LD LCVD L+ C L+ Sbjct: 888 TAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR 920 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G C C G LD + C D+D C++ Sbjct: 1005 TVGSFHCACAGGFALDAQERNCTDIDECRI 1034 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 130 DNPQIYEMGYTC---GWSRCDCNGDLVLDEETGLCVDLDACQL 249 +NP++ + G+ G RC C + + CVD+D C L Sbjct: 1202 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDL 1244 >AB177799-1|BAD16735.1| 2809|Homo sapiens fibrillin 3 protein. Length = 2809 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDAC 243 G RC CNG LD G C D++ C Sbjct: 1424 GMFRCICNGGYELDRGGGNCTDINEC 1449 Score = 29.5 bits (63), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVD--LDACQLK 252 T G RC+C L+LD LCVD L+ C L+ Sbjct: 888 TAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR 920 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G C C G LD + C D+D C++ Sbjct: 1005 TVGSFHCACAGGFALDAQERNCTDIDECRI 1034 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 130 DNPQIYEMGYTC---GWSRCDCNGDLVLDEETGLCVDLDACQL 249 +NP++ + G+ G RC C + + CVD+D C L Sbjct: 1202 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDL 1244 >AB177798-1|BAD16734.1| 2809|Homo sapiens fibrillin 3 protein. Length = 2809 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDAC 243 G RC CNG LD G C D++ C Sbjct: 1424 GMFRCICNGGYELDRGGGNCTDINEC 1449 Score = 29.5 bits (63), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVD--LDACQLK 252 T G RC+C L+LD LCVD L+ C L+ Sbjct: 888 TAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR 920 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G C C G LD + C D+D C++ Sbjct: 1005 TVGSFHCACAGGFALDAQERNCTDIDECRI 1034 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 130 DNPQIYEMGYTC---GWSRCDCNGDLVLDEETGLCVDLDACQL 249 +NP++ + G+ G RC C + + CVD+D C L Sbjct: 1202 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDL 1244 >AB177797-1|BAD16733.1| 2809|Homo sapiens fibrillin 3 protein. Length = 2809 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDAC 243 G RC CNG LD G C D++ C Sbjct: 1424 GMFRCICNGGYELDRGGGNCTDINEC 1449 Score = 29.5 bits (63), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVD--LDACQLK 252 T G RC+C L+LD LCVD L+ C L+ Sbjct: 888 TAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR 920 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G C C G LD + C D+D C++ Sbjct: 1005 TVGSFHCACAGGFALDAQERNCTDIDECRI 1034 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 130 DNPQIYEMGYTC---GWSRCDCNGDLVLDEETGLCVDLDACQL 249 +NP++ + G+ G RC C + + CVD+D C L Sbjct: 1202 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDL 1244 >AB053450-1|BAB47408.2| 2816|Homo sapiens fibrillin3 protein. Length = 2816 Score = 30.7 bits (66), Expect = 2.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 166 GWSRCDCNGDLVLDEETGLCVDLDAC 243 G RC CNG LD G C D++ C Sbjct: 1431 GMFRCICNGGYELDRGGGNCTDINEC 1456 Score = 29.5 bits (63), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVD--LDACQLK 252 T G RC+C L+LD LCVD L+ C L+ Sbjct: 895 TAGSFRCECPEGLMLDASGRLCVDVRLEPCFLR 927 Score = 29.5 bits (63), Expect = 5.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 160 TCGWSRCDCNGDLVLDEETGLCVDLDACQL 249 T G C C G LD + C D+D C++ Sbjct: 1012 TVGSFHCACAGGFALDAQERNCTDIDECRI 1041 Score = 29.1 bits (62), Expect = 7.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 130 DNPQIYEMGYTC---GWSRCDCNGDLVLDEETGLCVDLDACQL 249 +NP++ + G+ G RC C + + CVD+D C L Sbjct: 1209 ENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMRTCVDVDECDL 1251 >U33837-1|AAB41649.1| 4655|Homo sapiens gp330 precursor protein. Length = 4655 Score = 29.1 bits (62), Expect = 7.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 97 CDANTISQRTCDNPQIYEMGYTCGWSRCDC 186 C T Q TCDN Y C W + DC Sbjct: 142 CQYPTCEQLTCDNGACYNTSQKCDW-KVDC 170 >AY265358-1|AAP88586.1| 4655|Homo sapiens glycoprotein receptor gp330/megalin precursor protein. Length = 4655 Score = 29.1 bits (62), Expect = 7.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 97 CDANTISQRTCDNPQIYEMGYTCGWSRCDC 186 C T Q TCDN Y C W + DC Sbjct: 142 CQYPTCEQLTCDNGACYNTSQKCDW-KVDC 170 >AY265357-1|AAP88585.1| 4655|Homo sapiens glycoprotein receptor gp330/megalin precursor protein. Length = 4655 Score = 29.1 bits (62), Expect = 7.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 97 CDANTISQRTCDNPQIYEMGYTCGWSRCDC 186 C T Q TCDN Y C W + DC Sbjct: 142 CQYPTCEQLTCDNGACYNTSQKCDW-KVDC 170 >AC008178-1|AAY24266.1| 773|Homo sapiens unknown protein. Length = 773 Score = 29.1 bits (62), Expect = 7.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 97 CDANTISQRTCDNPQIYEMGYTCGWSRCDC 186 C T Q TCDN Y C W + DC Sbjct: 142 CQYPTCEQLTCDNGACYNTSQKCDW-KVDC 170 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,033,920 Number of Sequences: 237096 Number of extensions: 1163717 Number of successful extensions: 2840 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 2244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2840 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3701294870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -