BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10j01 (618 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0808 + 7418878-7420476 34 0.10 03_05_0105 - 20861130-20861384,20861472-20862262,20862364-208626... 27 9.0 >12_01_0808 + 7418878-7420476 Length = 532 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/56 (26%), Positives = 33/56 (58%) Frame = -1 Query: 381 LIFVNVTIAMVSTSTVRAVNAAAYMNHVAVCGFFMQIPIKSIMLVTKSHSSAMTIT 214 L F N++ A+ T ++ + +++N+ +CGF +Q+P +++ T+S + T T Sbjct: 255 LRFNNLSGAIPQTGSLASQGPTSFLNNPGLCGFPLQVPCRAVPPPTQSPPAPTTTT 310 >03_05_0105 - 20861130-20861384,20861472-20862262,20862364-20862618, 20862713-20862827,20862959-20863011,20863113-20863373, 20863699-20863749,20863863-20864114,20864504-20864726, 20865317-20865460 Length = 799 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 395 VPIAQTVVAVVGLLIWVYLIIVVKSYQNEM 484 VP+A +VV +V +++W Y + VK Y+ E+ Sbjct: 509 VPVAMSVVLMVVMIVWHY--VHVKRYKYEL 536 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,101,523 Number of Sequences: 37544 Number of extensions: 302332 Number of successful extensions: 664 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -