BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i24 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAP8A3.06 |||U2AF small subunit, U2AF-23|Schizosaccharomyces po... 30 0.38 SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 28 1.5 SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc... 27 2.0 SPAC12B10.04 |||tubulin-tyrosine ligase |Schizosaccharomyces pom... 27 3.5 SPBP35G2.03c |sgo1||shugoshin Sgo1|Schizosaccharomyces pombe|chr... 26 6.2 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 26 6.2 >SPAP8A3.06 |||U2AF small subunit, U2AF-23|Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 29.9 bits (64), Expect = 0.38 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = -3 Query: 438 QASCFGSIYFCRYSINNFLDILQLIICMYFLRYVRYEIAQKYYYENSCQS*IVDVNSR 265 Q F FC +S + ++ QL++C ++ + ++ YE S Q+ I D+NSR Sbjct: 72 QFDAFYEDMFCEFS--KYGEVEQLVVCDNVGDHLVGNVYVRFKYEESAQNAIDDLNSR 127 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 27.9 bits (59), Expect = 1.5 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 4/101 (3%) Frame = +1 Query: 322 SYLIPDVSQKIH-ANNELKDVKKVVNTITTEINRAEAACLSATDELCRLRCSVLDSTTET 498 S+ I D H N K +V + E +EA T + V + TE Sbjct: 1707 SFSIIDNDNPFHEGQNSSTGYKDIVQGLLAENGVSEAGVDVMTSIVSSTIPIVSNHQTEG 1766 Query: 499 SNMFSDVSACQSYCMHITRSEP---MRSEKKLGFLRKIFFP 612 S MF+++S+ S ++ S+P M +E K++ P Sbjct: 1767 SQMFNEISSVSSIHVYHDESQPPVEMPAESDTPLQNKLYHP 1807 >SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 27.5 bits (58), Expect = 2.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 585 WLSS*DILSEQKYFAQGNNNNVVCL 659 W +S +ILSE+KYF + N V L Sbjct: 892 WATSVEILSERKYFVTEADGNAVIL 916 >SPAC12B10.04 |||tubulin-tyrosine ligase |Schizosaccharomyces pombe|chr 1|||Manual Length = 403 Score = 26.6 bits (56), Expect = 3.5 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 642 CYFLVRSIFVRKEYLTKKAKLFFAAH 565 C +++R +RKEYL + + A H Sbjct: 68 CSYVIRKALIRKEYLWRTVITYLAKH 93 >SPBP35G2.03c |sgo1||shugoshin Sgo1|Schizosaccharomyces pombe|chr 2|||Manual Length = 319 Score = 25.8 bits (54), Expect = 6.2 Identities = 15/61 (24%), Positives = 29/61 (47%) Frame = +1 Query: 460 RLRCSVLDSTTETSNMFSDVSACQSYCMHITRSEPMRSEKKLGFLRKIFFPNKNTSHKEI 639 +L + +S E ++ + +SY + + R++ + L K FFP T HK+I Sbjct: 38 QLSIKIRESENEIQDLIQENFTLKSYLVKLEAR--FRNQSQTEDLLKNFFPEIQTIHKKI 95 Query: 640 T 642 + Sbjct: 96 S 96 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 25.8 bits (54), Expect = 6.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 579 KAWLSS*DILSEQKYFAQGNNNNVVC 656 +A+ S D L+E +YF GN N C Sbjct: 1484 RAYYSHLDYLTEVEYFIMGNPNQNAC 1509 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,801,383 Number of Sequences: 5004 Number of extensions: 56479 Number of successful extensions: 164 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -