BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i24 (716 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34150.1 68414.m04236 tRNA pseudouridine synthase family prot... 29 2.3 At5g62100.2 68418.m07795 BAG domain-containing protein similar t... 28 5.4 At5g62100.1 68418.m07794 BAG domain-containing protein similar t... 28 5.4 At1g48120.1 68414.m05370 calcineurin-like phosphoesterase family... 28 5.4 At4g00930.1 68417.m00126 COP1-interacting protein 4.1 (CIP4.1) i... 28 7.1 At1g08280.1 68414.m00914 glycosyl transferase family 29 protein ... 28 7.1 At4g24190.1 68417.m03472 shepherd protein (SHD) / clavata format... 27 9.4 At3g18485.1 68416.m02349 hypothetical protein 27 9.4 At2g34930.1 68415.m04288 disease resistance family protein conta... 27 9.4 >At1g34150.1 68414.m04236 tRNA pseudouridine synthase family protein similar to pseudouridine synthase 3 [Mus musculus] GI:9652099; contains Pfam profile PF01416: tRNA pseudouridine synthase Length = 446 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/69 (26%), Positives = 29/69 (42%) Frame = +1 Query: 451 ELCRLRCSVLDSTTETSNMFSDVSACQSYCMHITRSEPMRSEKKLGFLRKIFFPNKNTSH 630 EL LR V + E + + S VS+CQ M + + L R++ +KN+ Sbjct: 24 ELVFLRNRVKELEVENAKLLSQVSSCQCQQMEVKHDRSLSDSSSLVRRRRVRKGDKNSIP 83 Query: 631 KEITIMSYV 657 + YV Sbjct: 84 SHLISKRYV 92 >At5g62100.2 68418.m07795 BAG domain-containing protein similar to BAG domain containing proteins (At5g07220, At5g52060) Length = 285 Score = 28.3 bits (60), Expect = 5.4 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +1 Query: 499 SNMFSDVSACQSYCMHITRSEPMRSEKKLGFLRKIFFPNKNTSHKEITIMSY 654 S MF D+S + I +P+ EK+L LRKI K S K I+ +S+ Sbjct: 89 SKMFLDLSGVKDRSKLILIEDPISQEKRLLELRKI--ATKEKSSKAISDISF 138 >At5g62100.1 68418.m07794 BAG domain-containing protein similar to BAG domain containing proteins (At5g07220, At5g52060) Length = 296 Score = 28.3 bits (60), Expect = 5.4 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +1 Query: 499 SNMFSDVSACQSYCMHITRSEPMRSEKKLGFLRKIFFPNKNTSHKEITIMSY 654 S MF D+S + I +P+ EK+L LRKI K S K I+ +S+ Sbjct: 89 SKMFLDLSGVKDRSKLILIEDPISQEKRLLELRKI--ATKEKSSKAISDISF 138 >At1g48120.1 68414.m05370 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 1338 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +1 Query: 340 VSQKIHANNELKDVKK--VVNTITTEINRAEAACLSATDELCRLRCSVLDSTTETSNM 507 +S K N + K +K NT+ +R+E+ L + +L +++ V+D TE SN+ Sbjct: 782 LSDKQERNRKRKRTQKKQTDNTVLDTEDRSESLPLGSLKDLSKVKRRVIDPPTEGSNL 839 >At4g00930.1 68417.m00126 COP1-interacting protein 4.1 (CIP4.1) identical to cDNA CIP4.1 mRNA for COP1-interacting protein 4.1, GI:13160649 Length = 976 Score = 27.9 bits (59), Expect = 7.1 Identities = 19/67 (28%), Positives = 34/67 (50%) Frame = +1 Query: 349 KIHANNELKDVKKVVNTITTEINRAEAACLSATDELCRLRCSVLDSTTETSNMFSDVSAC 528 K++ NN+ K VKK+ N++T N++ +E + + DST S+ SD + Sbjct: 904 KMNVNNKEKAVKKISNSVTA--NKSTTNFFKDAEE-DESKTTTSDSTKAPSDSSSDNDSD 960 Query: 529 QSYCMHI 549 + MH+ Sbjct: 961 VTSSMHM 967 >At1g08280.1 68414.m00914 glycosyl transferase family 29 protein / sialyltransferase family protein contains Pfam profile: PF00777 sialyltransferase (Glycosyltransferase family 29) Length = 398 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +1 Query: 463 LRCSVL-DSTTETSNMFSDVSACQSYCMHITRSEPMRSEKKLGFLRKIFFPNKNTSHK 633 L C+V+ +S T ++ + D+ + + ++ R EKK+G I F N N H+ Sbjct: 175 LSCAVVGNSGTLLNSQYGDLIDKHEIVIRLNNAKTERFEKKVGSKTNISFINSNILHQ 232 >At4g24190.1 68417.m03472 shepherd protein (SHD) / clavata formation protein, putative nearly identical to SHEPHERD [Arabidopsis thaliana] GI:19570872; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 823 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 292 LATVFVIVLLSYLIPDVSQKIHANNE 369 L +V + L +L+PD +K+HAN E Sbjct: 6 LVSVLFLFSLLFLLPDQGRKLHANAE 31 >At3g18485.1 68416.m02349 hypothetical protein Length = 386 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -1 Query: 500 EVSVVLSSTEHLRRQSSSVADKQA 429 +V VVLS+ EHL + +ADK+A Sbjct: 279 QVMVVLSTPEHLPESPNCIADKRA 302 >At2g34930.1 68415.m04288 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 905 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 13 LTSSAVFVLTFNIKSKLRSQFKGHFPKCW 99 + SS V I S ++ F G FPKCW Sbjct: 607 IPSSLCEVSGLQILSLRKNHFSGSFPKCW 635 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,251,928 Number of Sequences: 28952 Number of extensions: 282659 Number of successful extensions: 722 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -