BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i22 (513 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2HCJ8 Cluster: Predicted protein; n=1; Chaetomium glob... 35 0.95 UniRef50_Q97L65 Cluster: Galactose mutarotase related enzyme; n=... 35 1.2 >UniRef50_Q2HCJ8 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 499 Score = 35.1 bits (77), Expect = 0.95 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +1 Query: 166 SHNGLKNKTPGVRLSNVTMPLF*SPANIGFLSPHR*PRISAKYDSMAY 309 +H G TPG R N P+F SPA+ SP R P ++K S++Y Sbjct: 76 AHTGASFVTPGTRDPNYLDPVFSSPASRTSRSPSRYPPSASKSGSLSY 123 >UniRef50_Q97L65 Cluster: Galactose mutarotase related enzyme; n=1; Clostridium acetobutylicum|Rep: Galactose mutarotase related enzyme - Clostridium acetobutylicum Length = 340 Score = 34.7 bits (76), Expect = 1.2 Identities = 23/59 (38%), Positives = 30/59 (50%) Frame = +1 Query: 139 FVFKLTFKRSHNGLKNKTPGVRLSNVTMPLF*SPANIGFLSPHR*PRISAKYDSMAYVK 315 F FKL+++ S GLK T V LS+ MPL ++G+ S P I DS VK Sbjct: 150 FQFKLSYELSSKGLKQTTSVVNLSSEEMPL-----SVGYHSAFNVPFIEGSEDSNCRVK 203 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 388,758,453 Number of Sequences: 1657284 Number of extensions: 6896004 Number of successful extensions: 11602 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11602 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31364627325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -