BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i22 (513 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0406 + 18663986-18664059,18665082-18665405,18665499-186655... 29 2.2 >02_03_0406 + 18663986-18664059,18665082-18665405,18665499-18665559, 18666136-18666282,18666368-18666492,18666619-18666648, 18666689-18666893,18667532-18667741,18667886-18667888, 18670034-18670942,18671239-18672069 Length = 972 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 234 IPSEYRLSFTSPLTTDLC*IRFNGLCEGGLFEC--LQHLEAIHND 362 IPS + +S S DLC +F+G G+ +C L+ L+A HN+ Sbjct: 550 IPSSFCISSLSFAALDLCYNQFSGEIPAGIGKCSALRMLKAGHNN 594 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,932,776 Number of Sequences: 37544 Number of extensions: 176654 Number of successful extensions: 250 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1106928780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -