BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i22 (513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 24 3.5 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 8.0 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.8 bits (49), Expect = 3.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 262 PHR*PRIS-AKYDSMAYVKEAFSSACNIWKRFTMIRLIGIFL 384 PH P I ++A KE+F +A N + RL+GI+L Sbjct: 30 PHLKPEIPYGNIRTVAEKKESFGTAINNLYHKSSDRLLGIYL 71 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 22.6 bits (46), Expect = 8.0 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 262 PHR*PRIS-AKYDSMAYVKEAFSSACNIWKRFTMIRLIGIFL 384 PH P I ++A KE+F A N + RL+GI+L Sbjct: 30 PHLKPEIPYGNIRTVAEKKESFGIAINNLYHKSSDRLLGIYL 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 417,002 Number of Sequences: 2352 Number of extensions: 6971 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -