BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i21 (624 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 27 2.2 SPBC2G2.06c |apl1||AP-2 adaptor complex subunit Apl1 |Schizosacc... 26 3.8 SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||... 25 6.7 SPBC1289.04c |pob1||Boi family protein|Schizosaccharomyces pombe... 25 6.7 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 27.1 bits (57), Expect = 2.2 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = +1 Query: 322 PSRAATRAPGPGSHAPERCPPMKDPRAPAYSMGARLGFAPRRAGPAPNAYA 474 PS P P + P PP + P P S+G P A P P A Sbjct: 1174 PSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSA 1224 Score = 25.4 bits (53), Expect = 6.7 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +1 Query: 322 PSRAATRAPGPGSHAPE-RCPPMKDPRAPAYSMGARLGFAPRRAGPAPNAYA 474 P A P P + P P K P PA S A PR + P+P++ A Sbjct: 1212 PPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVPSPHSNA 1263 >SPBC2G2.06c |apl1||AP-2 adaptor complex subunit Apl1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 677 Score = 26.2 bits (55), Expect = 3.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 389 FIGGQRSGACEPGPGARVAARDGN 318 F+ G + CEP P R+ RD N Sbjct: 581 FVKGAQVAYCEPSPVLRLRTRDSN 604 >SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 25.4 bits (53), Expect = 6.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 600 RFRPVYVSVPLEVDRRSRRLGFSL 529 R+ + V L R SRRLGF+L Sbjct: 344 RYNEALIDVSLRQSRMSRRLGFTL 367 >SPBC1289.04c |pob1||Boi family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 871 Score = 25.4 bits (53), Expect = 6.7 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -3 Query: 619 RPASTLAVSSCIR*RPSGSRPQVPETWL 536 RPAS+LAVS I+ P+ S +V E WL Sbjct: 233 RPASSLAVSEKIQNVPNWSTEEVVE-WL 259 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,085,686 Number of Sequences: 5004 Number of extensions: 36003 Number of successful extensions: 102 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -