BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i21 (624 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 27 0.37 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 25 1.5 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 1.5 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 2.0 AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A prot... 25 2.6 AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A prot... 25 2.6 AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A prot... 25 2.6 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 25 2.6 AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 prot... 25 2.6 DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 23 7.9 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 23 7.9 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 23 7.9 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 27.5 bits (58), Expect = 0.37 Identities = 19/67 (28%), Positives = 25/67 (37%) Frame = +1 Query: 352 PGSHAPERCPPMKDPRAPAYSMGARLGFAPRRAGPAPNAYALKLGSGSPAYTMGARVGFQ 531 PG PE P K + + S+G PR P L+ G P Y + + G Sbjct: 452 PGRPGPEGMPGDKGDKGESGSVGMPGPQGPRGYPGQPGPEGLRGEPGQPGYGIPGQKGNA 511 Query: 532 AKAKSPG 552 A PG Sbjct: 512 GMAGFPG 518 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 364 APERCPPMKDPRAP 405 A +RCPP DP+ P Sbjct: 17 ADDRCPPQDDPKQP 30 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.4 bits (53), Expect = 1.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 322 PSRAATRAPGPGSHAPERCPPMKDPRAPAY 411 PSR P P P R PP RAPA+ Sbjct: 388 PSRPTI--PAPQQQTPPRQPPATGDRAPAH 415 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 346 PGPGSHAPERCPPMKDPRAPAY 411 P P P R PP RAPA+ Sbjct: 393 PAPQQQTPPRQPPATGDRAPAH 414 >AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 364 APERCPPMKDPRAP 405 A +RCPP DP P Sbjct: 17 ADDRCPPQDDPEQP 30 >AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 364 APERCPPMKDPRAP 405 A +RCPP DP P Sbjct: 17 ADDRCPPQDDPEQP 30 >AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 364 APERCPPMKDPRAP 405 A +RCPP DP P Sbjct: 17 ADDRCPPQDDPEQP 30 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 364 APERCPPMKDPRAP 405 A +RCPP DP P Sbjct: 17 ADDRCPPQDDPEQP 30 >AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 protein. Length = 153 Score = 24.6 bits (51), Expect = 2.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 364 APERCPPMKDPRAP 405 A +RCPP DP P Sbjct: 17 ADDRCPPQDDPEQP 30 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 310 GARFPSRAATRAPGPGSHAPERCPPM 387 G PS R P P ++AP + P + Sbjct: 55 GTPAPSTVRPRPPAPPTNAPSQLPAL 80 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 364 APERCPPMKDPRAP 405 A RCPP DP P Sbjct: 17 ADVRCPPQDDPEQP 30 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 364 APERCPPMKDPRAP 405 A RCPP DP P Sbjct: 17 ADVRCPPQDDPEQP 30 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,301 Number of Sequences: 2352 Number of extensions: 10403 Number of successful extensions: 72 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -