BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i21 (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.0 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 7.4 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 7.4 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 9.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.8 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 24.2 bits (50), Expect = 1.0 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +3 Query: 63 AYLYSYIIKIQHGKKTFRARPRRVPAAHDGRPPAARPIALPEP 191 A LY Y I + T R P P G P+ P+A P Sbjct: 361 AMLYQYNFNIIISEPTERISPYGYPIGSGGSFPSLYPMATTSP 403 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 274 RDGLVSAPAWSFGARFPSRAAT 339 R+GL+ W +G F S AT Sbjct: 154 RNGLLPLLVWIYGGGFMSGTAT 175 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 274 RDGLVSAPAWSFGARFPSRAAT 339 R+GL+ W +G F S AT Sbjct: 154 RNGLLPLLVWIYGGGFMSGTAT 175 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.0 bits (42), Expect = 9.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 406 AYSMGARLGFAPRRAGPAPNAYAL 477 A +G LGF R A P P + L Sbjct: 72 AVLVGLILGFLGRLANPTPQSITL 95 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 129 RVPAAHDGRPPAARPIALP 185 R P+A GRP RP +P Sbjct: 1355 RGPSASGGRPVPERPERVP 1373 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,174 Number of Sequences: 438 Number of extensions: 3739 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -