BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i21 (624 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 30 1.1 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 29 2.5 At5g35230.1 68418.m04177 hypothetical protein 29 2.5 At2g47210.1 68415.m05896 myb family transcription factor contain... 29 2.5 At4g04990.1 68417.m00728 expressed protein contains Pfam domain ... 29 3.3 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 28 4.4 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 28 4.4 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 28 5.8 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 28 5.8 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 28 5.8 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 28 5.8 At2g01860.1 68415.m00119 pentatricopeptide (PPR) repeat-containi... 27 7.7 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 30.3 bits (65), Expect = 1.1 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +1 Query: 340 RAPGPGSHAPERCPPMKDPRAPAYSMGARLGFAPRRA-GPAPNAYALKLGSGSPAYTMGA 516 ++P P SH+P P +PA++ AP + AP+ S SPA++ Sbjct: 212 KSPSPVSHSPSHSPAHTPSHSPAHTPSHSPAHAPSHSPAHAPSHSPAHAPSHSPAHSPSH 271 Query: 517 RVGFQAKAKSPGPA 558 A KSP P+ Sbjct: 272 S---PATPKSPSPS 282 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +1 Query: 325 SRAATRAPGPGSHAPERCPPMKDPRAPAYSMGARLGFAPRRAGPAPNA 468 S + AP P S AP PP P P S G + P PNA Sbjct: 62 SSPPSSAPSPSSDAPTASPPA--PEGPGVSPGELAPTPSDASAPPPNA 107 >At5g35230.1 68418.m04177 hypothetical protein Length = 366 Score = 29.1 bits (62), Expect = 2.5 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 405 RSAGVLHRGAALGSVRARPWGASSRARRKPGAEAPG-GRGHE 283 R AGV+ A G+ R R +SR R + G APG GRG E Sbjct: 72 RPAGVVETEAVFGAGRRRRREGASRGRGR-GRAAPGRGRGRE 112 >At2g47210.1 68415.m05896 myb family transcription factor contains Pfam profile: PF00249 myb DNA-binding domain Length = 441 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 274 RDGLVSAPAWSFGARFPSRAATRAPGPGSHAPERCPPMKDPR 399 +D + + +SFGA P + + GPG A P K PR Sbjct: 393 KDRVFAPDPFSFGAERPIKKEQKRKGPGRQADTPSPAHKRPR 434 >At4g04990.1 68417.m00728 expressed protein contains Pfam domain PF05553: Cotton fiber expressed protein Length = 303 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +1 Query: 277 DGLVSAPAWSFGARFPSRAATRAPGPGSHAPERCPPMKDPRAPA 408 D +S +W +R PSRA P S +P + P +PA Sbjct: 197 DTKMSTSSWPLPSRSPSRARRPTPSLSSLSPSSSRARRPPSSPA 240 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 28.3 bits (60), Expect = 4.4 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +1 Query: 322 PSRAATRAPGPGSHAPERCPP--MKDPR-APAYSMGARLGFAPR-RAGPA 459 P R AP PGS P+ PP K PR P S+G + APR +GPA Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPK---APRPPSGPA 431 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 28.3 bits (60), Expect = 4.4 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +1 Query: 322 PSRAATRAPGPGSHAPERCPP--MKDPR-APAYSMGARLGFAPR-RAGPA 459 P R AP PGS P+ PP K PR P S+G + APR +GPA Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPK---APRPPSGPA 431 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +1 Query: 343 APGPGSHAPERCPPMKDPRAPAYSMGARLGFAPRRAGPAPNAYALKLGSGSPAYTM 510 AP P H PP P APA S+ R + P+ + L+ G PAY + Sbjct: 1156 APPPSDHC---LPPPTAPLAPAQSIALPPSSITRPSMPSHPSLPLQPGFAPPAYPL 1208 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +1 Query: 289 SAPAWSFGARFPSRAATRAPGPGSHAPERCPPMKDPR 399 SAPA S P + P P AP++ PP P+ Sbjct: 69 SAPAISISPSTPIPSTPSTPSPPPPAPKKSPPPPTPK 105 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 27.9 bits (59), Expect = 5.8 Identities = 24/96 (25%), Positives = 38/96 (39%), Gaps = 7/96 (7%) Frame = +1 Query: 343 APGPGSHAPERCPPM--KDPRAPAYSMGARLGFAPRRAGPAPNAYALKLGSGSPAYTMGA 516 +P P H PP P P YS ++ + ++ P P Y+ P Y+ Sbjct: 670 SPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHY---KSPPPPYVYS---SPPPPYYSPSP 723 Query: 517 RVGFQAKA-----KSPGPAVYFQRDANVYRTKPPMY 609 +V +++ SP P Y VY++ PP Y Sbjct: 724 KVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPY 759 Score = 27.5 bits (58), Expect = 7.7 Identities = 24/96 (25%), Positives = 38/96 (39%), Gaps = 7/96 (7%) Frame = +1 Query: 343 APGPGSHAPERCPPM--KDPRAPAYSMGARLGFAPRRAGPAPNAYALKLGSGSPAYTMGA 516 +P P H PP P P YS ++ + ++ P P Y+ P Y+ Sbjct: 695 SPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVY---KSPPPPYVYS---SPPPPYYSPSP 748 Query: 517 RVGFQAKA-----KSPGPAVYFQRDANVYRTKPPMY 609 +V +++ SP P Y VY++ PP Y Sbjct: 749 KVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPY 784 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 27.9 bits (59), Expect = 5.8 Identities = 20/70 (28%), Positives = 31/70 (44%) Frame = +1 Query: 289 SAPAWSFGARFPSRAATRAPGPGSHAPERCPPMKDPRAPAYSMGARLGFAPRRAGPAPNA 468 S P+ S + PS + +P P S +P PP +P S+ L +P + P+ +A Sbjct: 39 SPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPS-SA 97 Query: 469 YALKLGSGSP 498 L SP Sbjct: 98 PPSSLSPSSP 107 >At2g01860.1 68415.m00119 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 486 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 126 RRVPAAHDGRPPAARPIALPEPHVL 200 +R+P D +P RP+ LP+PH L Sbjct: 107 KRIPQKPD-KPSRVRPLPLPQPHKL 130 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,798,111 Number of Sequences: 28952 Number of extensions: 230596 Number of successful extensions: 833 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -