BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i18 (602 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02220.1 68417.m00300 zinc finger (MYND type) family protein ... 30 1.0 At5g22310.1 68418.m02603 expressed protein 29 2.4 At5g44180.1 68418.m05406 homeobox transcription factor, putative... 29 3.1 At4g04940.1 68417.m00718 transducin family protein / WD-40 repea... 28 4.1 At1g64330.1 68414.m07290 myosin heavy chain-related similar to m... 28 4.1 At2g36420.1 68415.m04471 expressed protein 28 5.5 At4g08990.1 68417.m01485 DNA (cytosine-5-)-methyltransferase, pu... 27 7.2 At5g24540.1 68418.m02898 glycosyl hydrolase family 1 protein con... 27 9.6 At3g26990.1 68416.m03377 expressed protein contains Pfam domain,... 27 9.6 >At4g02220.1 68417.m00300 zinc finger (MYND type) family protein / programmed cell death 2 C-terminal domain-containing protein similar to SP|Q16342 Programmed cell death protein 2 (Zinc finger protein Rp-8) {Homo sapiens}; contains Pfam profiles PF01753: MYND finger, PF04194: Programmed cell death protein 2, C-terminal putative domain Length = 418 Score = 30.3 bits (65), Expect = 1.0 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +3 Query: 201 HHAYVVTWSGWKCWHGQRLVACALYGTKNAQFCLPKEE 314 H A + TW G W G +L C+ G KNA++C PK + Sbjct: 183 HGAPLCTWCG--TWKGDKL--CS--GCKNARYCSPKHQ 214 >At5g22310.1 68418.m02603 expressed protein Length = 481 Score = 29.1 bits (62), Expect = 2.4 Identities = 35/119 (29%), Positives = 50/119 (42%) Frame = +2 Query: 242 ARPTARRLRSLWDEKCAILPPERRDKIKSALEEDYFLSPEQTEQYFQALSESSKRWSGPG 421 AR + + L S DE+ E+R I+S EE E+ + +E R G Sbjct: 224 ARSSLKHLMSELDEE----EEEKRRLIESLQEE------AMVERKLRRRTEKMNRRLGRE 273 Query: 422 GTVNRKELIDKQKELQQRQKWLVNFSAQVAYHLCDYIAKGQKEMLVSNRLRSIADVVLE 598 T KE K KE +R+K + +V L I +KEM + IADV+ E Sbjct: 274 LT-EAKETERKMKEEMKREKRAKDVLEEVCDELTKGIGDDKKEMEKEREMMHIADVLRE 331 >At5g44180.1 68418.m05406 homeobox transcription factor, putative similar to homeobox transcription factor Hox7/homeotic protein Hox7 (GI:19486) {Lycopersicon peruvianum}; similar to GP|4165087| Williams-Beuren syndrome deletion transcript 9 [Homo sapiens]; contains Pfam PF02791: DDT domain and Pfam PF00046: Homeobox domain Length = 1694 Score = 28.7 bits (61), Expect = 3.1 Identities = 30/123 (24%), Positives = 54/123 (43%), Gaps = 1/123 (0%) Frame = +2 Query: 206 RLRRNMERVEMLARPTARRLRSLWDEKCAILPPERRDKIKSALEEDYFLSPEQTEQYF-Q 382 R+RR +E+ +ML R ++R + + ERR + + L E + E+Y + Sbjct: 345 RIRRELEKQDMLRRKREEQIRKEMERQ----DRERRKEEERLLRE----KQREEERYLKE 396 Query: 383 ALSESSKRWSGPGGTVNRKELIDKQKELQQRQKWLVNFSAQVAYHLCDYIAKGQKEMLVS 562 + E +R R E + +QKE +++K + A + IAK E++ Sbjct: 397 QMRELQRREKFLKKETIRAEKM-RQKEEMRKEKEVARLKAANERAIARKIAKESMELIED 455 Query: 563 NRL 571 RL Sbjct: 456 ERL 458 >At4g04940.1 68417.m00718 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats Length = 910 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = +2 Query: 173 DSEGSNQKIPPRLRRNMERVEMLARPTARRLRSLWDEK 286 +++G N++ + + +M+ + L P ++ L+S WD K Sbjct: 751 EADGENEENNKKDQNSMKNFDALESPFSKHLKSSWDSK 788 >At1g64330.1 68414.m07290 myosin heavy chain-related similar to myosin heavy chain (GI:1850913) [Entamoeba histolytica]; similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae] Length = 555 Score = 28.3 bits (60), Expect = 4.1 Identities = 19/99 (19%), Positives = 47/99 (47%), Gaps = 2/99 (2%) Frame = +2 Query: 305 ERRDKIKSALEEDYFLSPEQTEQYFQALSESSKRWSGPGGTVNRKE--LIDKQKELQQRQ 478 E R+ L +DY + E E+Y + E+ +R G V +E ++D ++ ++ + Sbjct: 289 EEREATIKKLTDDYKQAREMLEEYMSKMEETERRMQETGKDVASRESAIVDLEETVESLR 348 Query: 479 KWLVNFSAQVAYHLCDYIAKGQKEMLVSNRLRSIADVVL 595 + ++ L + ++ + ++ +SN+ + + VL Sbjct: 349 NEVERKGDEIE-SLMEKMSNIEVKLRLSNQKLRVTEQVL 386 >At2g36420.1 68415.m04471 expressed protein Length = 439 Score = 27.9 bits (59), Expect = 5.5 Identities = 24/105 (22%), Positives = 44/105 (41%) Frame = +2 Query: 191 QKIPPRLRRNMERVEMLARPTARRLRSLWDEKCAILPPERRDKIKSALEEDYFLSPEQTE 370 Q+ RL + + R E LA L E+ E ++ + + E+D + E Sbjct: 287 QRAKRRLLKKLRRFEKLAGLDPVELEGKMSEE----EDEEEEEYEESEEDDNIRIYDSDE 342 Query: 371 QYFQALSESSKRWSGPGGTVNRKELIDKQKELQQRQKWLVNFSAQ 505 +Y + + E+ R S RK+ ++QK+ + W V A+ Sbjct: 343 EY-EDVDEAMARESRCAEDEKRKKNDERQKKWRMMNAWRVGLGAE 386 >At4g08990.1 68417.m01485 DNA (cytosine-5-)-methyltransferase, putative strong similarity to cytosine-5 methyltransferase (METII) [Arabidopsis thaliana] GI:6523846; contains Pfam profiles PF01426: BAH domain, PF00145: C-5 cytosine-specific DNA methylase Length = 1512 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/70 (22%), Positives = 31/70 (44%) Frame = +2 Query: 164 KKVDSEGSNQKIPPRLRRNMERVEMLARPTARRLRSLWDEKCAILPPERRDKIKSALEED 343 KK+ +G N L + R++ + T R + +W E +I PE + +EE+ Sbjct: 582 KKILQKGKNLNPRAGLAHVVTRMKPMQATTTRLVNRIWGEFYSIYSPEVPSEAIHEVEEE 641 Query: 344 YFLSPEQTEQ 373 E+ ++ Sbjct: 642 EIEEDEEEDE 651 >At5g24540.1 68418.m02898 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to amygdalin hydrolase isoform AH I precursor (GI:16757966) [Prunus serotina] Length = 534 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 422 GTVNRKELIDKQKELQQRQKWLVNFSAQVAYHLCD 526 GTV R+E+++ K ++ QK L + CD Sbjct: 426 GTVTREEILEDTKRIEYHQKHLQELQKAITEDGCD 460 >At3g26990.1 68416.m03377 expressed protein contains Pfam domain, PF04818: Protein of unknown function, DUF618 Length = 513 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 197 IPPRLRRNMERVEMLARPTARRLRSLWDEK 286 +P LR +E + R +ARRL ++W+E+ Sbjct: 86 LPDALRDMIENGDDFGRKSARRLVNIWEER 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,061,592 Number of Sequences: 28952 Number of extensions: 270633 Number of successful extensions: 902 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -