BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i16 (520 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 23 1.2 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 1.2 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 1.6 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 21 8.7 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 21 8.7 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 413 DSEQPPELLKAAVPRRGAKLNARSTS 336 D +PPEL + GA+ NA STS Sbjct: 37 DGGKPPELTGSTNGDGGARSNADSTS 62 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 413 DSEQPPELLKAAVPRRGAKLNARSTS 336 D +PPEL + GA+ NA STS Sbjct: 193 DGGKPPELTGSTNGDGGARSNADSTS 218 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.0 bits (47), Expect = 1.6 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -3 Query: 497 TRKTKNTVRTASYNIKRPVADIPQHPNHDSEQPPELLKAAVP 372 TR T R + Y ++RP + P H PP+ ++ A P Sbjct: 256 TRTTLKNNRASPYPMQRPKSASLSPPPH-VYNPPDHIQQATP 296 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = +2 Query: 230 CGSKVISEPPYPNKNCD 280 CG + EPP + +C+ Sbjct: 80 CGDRTQLEPPISSPHCE 96 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = +2 Query: 230 CGSKVISEPPYPNKNCD 280 CG + EPP + +C+ Sbjct: 80 CGDRTQLEPPISSPHCE 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,828 Number of Sequences: 336 Number of extensions: 1947 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12468463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -