BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i12 (670 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20770.1 68416.m02627 ethylene-insensitive 3 (EIN3) identical... 31 0.69 At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family pro... 30 1.6 At5g21120.1 68418.m02518 ethylene-insensitive3-like2 (EIL2) iden... 29 2.1 At2g27050.1 68415.m03250 ethylene-insensitive3-like1 (EIL1) iden... 29 2.1 At2g15550.1 68415.m01781 hypothetical protein similar to zinc fi... 29 2.8 At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family pro... 29 3.7 At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containi... 28 4.9 At2g37730.1 68415.m04627 fringe-related protein similarity to pr... 28 4.9 At5g10120.1 68418.m01172 ethylene insensitive 3 family protein c... 28 6.5 At4g33400.1 68417.m04747 dem protein-related / defective embryo ... 28 6.5 At1g63540.1 68414.m07183 hydroxyproline-rich glycoprotein family... 28 6.5 At2g38560.1 68415.m04737 transcription factor S-II (TFIIS) domai... 27 8.5 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 27 8.5 >At3g20770.1 68416.m02627 ethylene-insensitive 3 (EIN3) identical to ethylene-insensitive3 GI:2224933 from [Arabidopsis thaliana] Length = 628 Score = 31.1 bits (67), Expect = 0.69 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 236 ACMQHTRPPDCRCPQYSGGEMPQLPPGKEGGW 331 A MQH PP R P G P P GKE W Sbjct: 192 ALMQHCDPPQRRFPLEKGVPPPWWPNGKEDWW 223 >At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 159 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 592 TLEFSSGSCFAVIYPVSGLVSISVDPLLELWRR-FVLED 479 T+ F S A + P +G+V S P+L WRR F +ED Sbjct: 80 TVRFQSRINMACVNPENGVVDPSHFPMLSNWRREFTMED 118 >At5g21120.1 68418.m02518 ethylene-insensitive3-like2 (EIL2) identical to ethylene-insensitive3-like2 (EIL2) GI:2224929 from [Arabidopsis thaliana] Length = 518 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 224 AFYQACMQHTRPPDCRCPQYSGGEMPQLPPGKEGGWSR 337 A A H PP R P G P P GKE W + Sbjct: 191 ALLSALFPHCNPPQRRFPLEKGVTPPWWPTGKEDWWDQ 228 >At2g27050.1 68415.m03250 ethylene-insensitive3-like1 (EIL1) identical to ethylene-insensitive3-like1 GI:2224927 from [Arabidopsis thaliana] Length = 584 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/62 (32%), Positives = 24/62 (38%), Gaps = 6/62 (9%) Frame = +2 Query: 164 GGDGETSGLADTPKLSGQEL------AFYQACMQHTRPPDCRCPQYSGGEMPQLPPGKEG 325 GG + + L + QEL + A MQH PP R P G P P G E Sbjct: 164 GGSNDCNSLVGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPNGNEE 223 Query: 326 GW 331 W Sbjct: 224 WW 225 >At2g15550.1 68415.m01781 hypothetical protein similar to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 589 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +2 Query: 257 PPDCRCPQYSGGEMPQLPPGKEGGWSRNEIMGPLLDPKLYPVRVAASPETPTSRYDQP 430 PP R P +S GE PP K+ ++ L D L P R +PT ++P Sbjct: 280 PPSSR-PYHSRGEKSSAPPNKQSSPLLSDSQLTLSDTVLAPSRAKQITSSPTYVRERP 336 >At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 158 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 592 TLEFSSGSCFAVIYPVSGLVSISVDPLLELWRR-FVLED 479 T+ F + A + P +G+V S+ P+L WRR + +ED Sbjct: 80 TVRFQTRINMACVNPETGVVEPSLFPMLTNWRREYTMED 118 >At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 551 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = -3 Query: 344 SHSDSSRPPSQAAVAASPLQSTAGIGSRAASYAA 243 S SDSS P S ++V++SP S++ + S SY++ Sbjct: 451 SDSDSSSPDSSSSVSSSP-DSSSSVSSSPDSYSS 483 >At2g37730.1 68415.m04627 fringe-related protein similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 532 Score = 28.3 bits (60), Expect = 4.9 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 1/76 (1%) Frame = -3 Query: 431 WADRSEMLEFQDSQRLARDTVLDLGEDPLSHSD-SSRPPSQAAVAASPLQSTAGIGSRAA 255 W DRS E + R + E PL+ + S+ PP Q + S T GSR+A Sbjct: 112 WRDRSRYSELWWRPNVTRGFIWLDEEPPLNMTWLSTSPPYQVSADTSRFSYTCWYGSRSA 171 Query: 254 SYAACMLGRTLILDQT 207 A ++ T L T Sbjct: 172 IRMARIIKETFELGLT 187 >At5g10120.1 68418.m01172 ethylene insensitive 3 family protein contains Pfam profile: PF04873 ethylene insensitive 3 Length = 471 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 236 ACMQHTRPPDCRCPQYSGGEMPQLPPGKEGGW 331 A MQH PP R P G P P G E W Sbjct: 169 ALMQHCMPPQRRFPLEKGIAPPWWPTGTELWW 200 >At4g33400.1 68417.m04747 dem protein-related / defective embryo and meristems protein-related identical to dem GI:2190419 from [Lycopersicon esculentum] Length = 645 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 398 PETPTSRYDQPNAFLDKLQSKYPMLYSILQNEASPELKQRIDRDRNKTTY 547 P++P+S D A L L+ KYP+ S + S L + I+ + K + Sbjct: 56 PKSPSSSLDDVEAKLQALKLKYPLTQSAPSTQNSARLFRYINGNTPKAKW 105 >At1g63540.1 68414.m07183 hydroxyproline-rich glycoprotein family protein Length = 635 Score = 27.9 bits (59), Expect = 6.5 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 6/61 (9%) Frame = -2 Query: 444 SKNALG*S*RDVGV-----SGLAATRTGYSFGSRRGPIIS-FRLQPPSFPGGSCGISPPE 283 S N LG + GV S L ++ G+ G G + FR PP+F GGS G P Sbjct: 368 SSNLLGQNPSTTGVGYLPGSPLNSSFPGFGVGYLPGSSSNLFRSNPPNFGGGSIGAGPQH 427 Query: 282 Y 280 + Sbjct: 428 F 428 >At2g38560.1 68415.m04737 transcription factor S-II (TFIIS) domain-containing protein similar to SP|P49373 Transcription elongation factor S-II (TFIIS) {Schizosaccharomyces pombe}; contains Pfam profile PF01096: Transcription factor S-II (TFIIS) Length = 378 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -1 Query: 553 YPVSGLVSISVDPLLELWRRFVLEDAVQ 470 +PV + S++ D LLE+W++ V+E+ + Sbjct: 66 HPVEDIKSVATD-LLEIWKKVVIEETAK 92 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +2 Query: 122 TYRKDYLWPNLPHVGGDGETSGLADTPKLSGQELAFYQACMQHTRPPDCR 271 +Y D+L LP D TSG A+ P G L +Q DC+ Sbjct: 1551 SYSTDHLTTGLPESIMDSATSGEANFPHSGGDTLKTSDTLIQTGYASDCQ 1600 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,008,714 Number of Sequences: 28952 Number of extensions: 400648 Number of successful extensions: 1188 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1186 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -