BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i11 (632 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A12.19 |||mitochondrial ribosomal protein subunit L27|Schiz... 27 2.3 SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces... 27 3.0 SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 25 6.9 SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr 2||... 25 6.9 SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ... 25 6.9 SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 25 9.1 SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosacchar... 25 9.1 SPBC2G2.08 |ade9||C-1-tetrahydrofolatesynthase/methylenetetrahyd... 25 9.1 >SPAC3A12.19 |||mitochondrial ribosomal protein subunit L27|Schizosaccharomyces pombe|chr 1|||Manual Length = 93 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -3 Query: 249 PMSTKVGISFHKGANR-LNGERFSHGN--VNWSSV 154 PM+TK+G ++KG G++ HG V WS V Sbjct: 14 PMTTKLGHQYYKGTRTGKMGQKTRHGGFLVQWSRV 48 >SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1441 Score = 26.6 bits (56), Expect = 3.0 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 140 QPVSITDDQFTFPWLNLSPFSLFAPL-WKLIPTF 238 +P +ITDD P N L +PL W +I ++ Sbjct: 1058 EPYAITDDNDYLPMANTGSLDLVSPLTWTVIDSY 1091 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 25.4 bits (53), Expect = 6.9 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +2 Query: 449 DVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPYK 574 D+ +L ++ L ++AP + +T +V+ + PY+ Sbjct: 111 DIKKDLATESQLPLSAPFKDESTRTMTDPQVLAYIHQSMPYQ 152 >SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr 2|||Manual Length = 525 Score = 25.4 bits (53), Expect = 6.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 411 KNWLANTSWSSSLASCDPWTKIKS 340 + W+ N+S S L CD KI+S Sbjct: 187 EKWMKNSSISEYLQECDSMAKIES 210 >SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion cytochrome c oxidase assembly protein Cox1102, mitochondrial ribosomal protein Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 25.4 bits (53), Expect = 6.9 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +2 Query: 449 DVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPYK 574 D+ +L ++ L ++AP + +T +V+ + PY+ Sbjct: 111 DIKKDLATESQLPLSAPFKDESTRTMTDPQVLAYIHQSMPYQ 152 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 25.0 bits (52), Expect = 9.1 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +2 Query: 425 LPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVET 559 LP S++ + + + G ++ PI+ V T + +PI T Sbjct: 222 LPTTSTSCTTSTSIPTGGSSSLSTPITPTVPPTSTSSTSIPIPPT 266 >SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1131 Score = 25.0 bits (52), Expect = 9.1 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -3 Query: 561 PVSTIGTTRSVFFVLSTFSLIGAVTTRYPSEVSSAVTSAAL 439 P + TT S+ + +T + V TRY + S+ VTS+++ Sbjct: 451 PTVSSSTTGSLHYKTTTTVWVTEVFTRYLGDDSTPVTSSSI 491 >SPBC2G2.08 |ade9||C-1- tetrahydrofolatesynthase/methylenetetrahydrofolatedehydr ogenase/methylenetetrahydrofolatecyclohydrolase/formylte trahydrofolatesynthetase|Schizosaccharomyces pombe|chr 2|||Manual Length = 969 Score = 25.0 bits (52), Expect = 9.1 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Frame = -3 Query: 255 LGPMSTKVGISFHKGANRLNGERFSHGNVNWSSVMETGCAITSLSRAGKAVTVAKPAKAM 76 L P S V + + A + NG+R G+V++ S + +IT + +TVA + + Sbjct: 254 LKPGSVVVDVGIN--AVQRNGKRVLVGDVHFESASKVASSITPVPGGVGPMTVAMLMENI 311 Query: 75 KTAKR--RGENIFLDI 34 A + R ENI+ I Sbjct: 312 VNAAKIARTENIYRKI 327 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,151,859 Number of Sequences: 5004 Number of extensions: 37732 Number of successful extensions: 136 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 281707720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -