BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i11 (632 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34320.1 68414.m04259 expressed protein contains Pfam domain ... 32 0.36 At5g58300.1 68418.m07298 leucine-rich repeat transmembrane prote... 29 1.9 At3g49800.1 68416.m05445 BSD domain-containing protein contains ... 29 2.6 At2g04900.1 68415.m00509 expressed protein 29 2.6 At1g64550.1 68414.m07317 ABC transporter family protein similar ... 28 4.5 At3g11310.1 68416.m01375 hypothetical protein 28 5.9 At3g07090.1 68416.m00843 expressed protein 28 5.9 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 28 5.9 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 28 5.9 >At1g34320.1 68414.m04259 expressed protein contains Pfam domain PF05003: protein of unknown function (DUF668) Length = 657 Score = 31.9 bits (69), Expect = 0.36 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 407 FFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTER--VVPIVETGA 565 F H +N++A+D+ + G +P++ENVD K+T PIV +G+ Sbjct: 19 FAHVNGHHLNNNASDLNSHSGESGLKDDPSPVTENVDDNKHTSESFSFPIVSSGS 73 >At5g58300.1 68418.m07298 leucine-rich repeat transmembrane protein kinase, putative Length = 654 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = -3 Query: 237 KVGISFHKGANRLN---GERFSHGNVNWSSVMETGCAITSLSRAGKAVTVAKPAKAMKTA 67 K+ +S KG L+ G +FSHGN+ S+V+ + +S G +A P M+ A Sbjct: 461 KITLSAAKGIAHLHAAGGPKFSHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGA 520 Query: 66 KRRGENI 46 R + Sbjct: 521 GYRAPEV 527 >At3g49800.1 68416.m05445 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 428 Score = 29.1 bits (62), Expect = 2.6 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 3/79 (3%) Frame = +2 Query: 386 HDVFASQFFHTYSLP-VNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETG 562 H +F+ T S P V S A ++ EL T + E+ D+ ++E V P+ + Sbjct: 244 HPIFSKHDALTLSTPQVLESRALLSHELLRKRNKD-TVVVPESSDRGADSENVEPLFQPT 302 Query: 563 APYKKDEP--VEKTTVETL 613 P K EP V+ TVET+ Sbjct: 303 NPSPKSEPEPVKTITVETI 321 >At2g04900.1 68415.m00509 expressed protein Length = 128 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = -3 Query: 540 TRSVFFVLSTFSLIGAVTTRYPSEVSSAVTSAALEFTG 427 T S++ ++ T +L+ A +T+YP+ +T+ + F+G Sbjct: 58 TASLYHLVHTAALVSAPSTKYPNIFGGLLTAGIVAFSG 95 >At1g64550.1 68414.m07317 ABC transporter family protein similar to ABC transporter protein GB:AAF31030 GI:6899653 from [Leishmania major] Length = 715 Score = 28.3 bits (60), Expect = 4.5 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = +2 Query: 425 LPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIV----ETGAPYKKDEPVE 592 +P N V E+ D + ++ ++++TK E + I+ ET P KD Sbjct: 228 IPTNCQILHVEQEVVGDKTTALQCVLNTDIERTKLLEEEIQILAKQRETEEPTAKDGMPT 287 Query: 593 KTTVE 607 K TVE Sbjct: 288 KDTVE 292 >At3g11310.1 68416.m01375 hypothetical protein Length = 539 Score = 27.9 bits (59), Expect = 5.9 Identities = 17/68 (25%), Positives = 30/68 (44%), Gaps = 7/68 (10%) Frame = +2 Query: 353 VQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELT-------SDGYLVVTAPISEN 511 V GS+ +DDH + F + P +SS D+ +T D Y+V+ + Sbjct: 339 VPGSEGGADDDHHIVMDHHFESPHDPASSSEIDLNEPVTGSEGGADDDHYIVLNHLVESP 398 Query: 512 VDKTKNTE 535 D+ ++E Sbjct: 399 HDRAPSSE 406 >At3g07090.1 68416.m00843 expressed protein Length = 265 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +2 Query: 473 DGYLVVTAPISENVDKTKNTERVVPIVETGAPYK--KDEPV 589 DG +V AP E + + TE+V P+++ A + KD+P+ Sbjct: 177 DGPQIVIAPKLEAAETSTATEKVPPVIQPSASKEKVKDDPL 217 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 492 VTTRYPSEVSSAVTSAALEFTGRL*VWKN 406 V R PSE++S++ +A L T +L VW + Sbjct: 536 VVNRIPSELASSIAAAELPCTVKLRVWSH 564 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 492 VTTRYPSEVSSAVTSAALEFTGRL*VWKN 406 V R PSE++S++ +A L T +L VW + Sbjct: 536 VVNRIPSELASSIAAAELPCTVKLRVWSH 564 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,397,693 Number of Sequences: 28952 Number of extensions: 201226 Number of successful extensions: 633 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 633 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -