BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i06 (315 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-3957|AAF56597.1| 1304|Drosophila melanogaster CG6490-PA... 28 2.2 AE014296-1684|AAZ66069.1| 189|Drosophila melanogaster CG33700-P... 27 6.7 >AE014297-3957|AAF56597.1| 1304|Drosophila melanogaster CG6490-PA protein. Length = 1304 Score = 28.3 bits (60), Expect = 2.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 98 LCSPIYFCRQITNSKIILRLLR 163 +C P+YF +TN +ILR LR Sbjct: 207 VCKPLYFALILTNGTLILRHLR 228 >AE014296-1684|AAZ66069.1| 189|Drosophila melanogaster CG33700-PA protein. Length = 189 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 278 SSEITIRCYRAYNGYN*MFSLKTFTFSYFMNN 183 S +I + Y+ NGY +T F Y+M N Sbjct: 82 SVDINVALYKKSNGYRPFLFNQTLDFCYYMRN 113 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,218,494 Number of Sequences: 53049 Number of extensions: 232667 Number of successful extensions: 462 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 631882260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -