BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i04 (709 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0628 - 25643006-25643123,25643314-25643471,25643559-256436... 123 2e-28 01_05_0142 - 18564697-18564792,18564824-18564928,18565606-185656... 33 0.17 05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969,116... 30 2.1 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 29 2.7 10_01_0359 + 3956527-3956616,3957623-3957818,3958102-3959418,395... 29 4.8 04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035,807... 29 4.8 09_02_0062 - 3742857-3743045,3744641-3744916,3745933-3745992,374... 28 6.3 02_01_0336 + 2397648-2397812,2398367-2398441,2398860-2398975,239... 28 6.3 03_06_0724 - 35757228-35757323,35757837-35757893,35757983-357580... 28 8.4 >11_06_0628 - 25643006-25643123,25643314-25643471,25643559-25643687, 25644378-25644451,25644771-25644798 Length = 168 Score = 123 bits (296), Expect = 2e-28 Identities = 71/174 (40%), Positives = 103/174 (59%), Gaps = 3/174 (1%) Frame = +3 Query: 78 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEG 248 M +Y+D++TGDE+ SD++ + ++ +++EV G+ V + D+ I G NPSAE DEG Sbjct: 1 MLVYQDLLTGDELLSDSFPYREIENGILWEVDGKWVVQGAIDVDI-GANPSAEGGGDDEG 59 Query: 249 TDSAVESGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMN 428 D VDIV RL E F DKK + ++K Y+K L AKL+ ++ E FK N+ Sbjct: 60 VDDQAVKVVDIVDTFRLQEQPPF-DKKQFVTFMKRYIKNLSAKLDA---EKQEEFKKNIE 115 Query: 429 KVMKDILGRFKELQFFTGESMDCDGMVAMMEYRDFDGTQIPIMMFFKHGLEEEK 590 K +LG+ K+LQFF GESM DG + Y+ DG P ++F HGL+E K Sbjct: 116 GATKYLLGKLKDLQFFVGESMHDDGGLVFAYYK--DGATDPTFLYFSHGLKEVK 167 >01_05_0142 - 18564697-18564792,18564824-18564928,18565606-18565678, 18566262-18567637 Length = 549 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = -3 Query: 521 FHHGNHAITIHRLPSKEL----KFLKPAEDVFHYFVHVCFKYFNLVRRL 387 FHH H ++ PSK+L ++L+ FH F ++C++Y + R+L Sbjct: 245 FHHMLHLFQMYLKPSKKLVEGSQYLERGR-YFHSFANICYRYLKIGRKL 292 >05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969, 1164082-1164240,1164663-1164797,1165116-1165268, 1165358-1165479,1165599-1166541,1166677-1166728, 1166873-1167963,1168058-1168384,1168479-1168559, 1168649-1168717,1168809-1168937,1169038-1169121, 1169210-1169275 Length = 1321 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +3 Query: 318 GDKKSYTL-YLKDYMKKLV-AKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESM 491 G +K TL L++Y+ +V A L+ +Q+E FK +NKV K L+ F+ + M Sbjct: 1140 GSEKMVTLDNLEEYVSSIVDATLKSGISNQIEAFKAGINKVF-----ALKTLRLFSEDEM 1194 Query: 492 D 494 + Sbjct: 1195 E 1195 >02_05_1057 + 33809982-33810366,33810436-33810687,33810727-33810926, 33811021-33811122 Length = 312 Score = 29.5 bits (63), Expect = 2.7 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +3 Query: 114 MFSDTYKMKLVDEVI-YEVTGRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESGVDIVLN 290 +FS VDE I +E+ + G+I ++GF G D+AVE ++ V Sbjct: 101 LFSGAETTDEVDEYIEFEINVGCIGGGGGNITVDGFRGGGSGGGRGGDAAVEIEINEV-- 158 Query: 291 HRLVETYAFGDKKS--YTLYLKD 353 R+ E K S Y L L D Sbjct: 159 -RVSEVRGIAGKASGTYVLVLLD 180 >10_01_0359 + 3956527-3956616,3957623-3957818,3958102-3959418, 3959482-3960445,3960588-3960648,3961500-3961946 Length = 1024 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/65 (27%), Positives = 30/65 (46%) Frame = +3 Query: 291 HRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 470 H L+ A D S +L ++++ V +E+A Q+EV K + K+I EL Sbjct: 177 HELIRAGAENDALSRSLEEREHLMMKVGGEKEQAESQIEVLKGTIQSGEKEISSLKYELH 236 Query: 471 FFTGE 485 + E Sbjct: 237 VLSKE 241 >04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035, 8078108-8078360,8078613-8078768,8078854-8079770, 8079858-8079927,8082310-8082416,8082722-8082755, 8083621-8083940,8084031-8084820,8084890-8085046, 8085647-8086068 Length = 1255 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = +3 Query: 183 TRAQGDIQIEGFNPSAEEADEGTDSAVESGVD--IVLNHRLVETYAFGD 323 TR+ +Q++GF PSA ++ +G+ + V S + IV +L +T G+ Sbjct: 827 TRSSDKVQLKGFVPSAPKSSQGSRTYVSSAKNRFIVPKEQLQKTSTEGN 875 >09_02_0062 - 3742857-3743045,3744641-3744916,3745933-3745992, 3746554-3748102,3748183-3748418 Length = 769 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 201 IQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGDKK 329 + I N S EE +E ++A VD+ LN +E +G+KK Sbjct: 711 VSINYENASLEEVEEA-EAAARYAVDVHLNRPTLELKRYGEKK 752 >02_01_0336 + 2397648-2397812,2398367-2398441,2398860-2398975, 2399155-2399269,2399360-2399488,2399809-2399856, 2400369-2400448,2400628-2400824,2400916-2401202, 2401281-2401307,2401353-2401538,2401633-2402094, 2402201-2402350,2402612-2402687,2402851-2402978, 2403244-2403435,2403559-2403690,2403767-2403889, 2404128-2404346,2404518-2404679 Length = 1022 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 393 APSLPILLLIFSYSL*GTMCRISCHRRRMFRLA 295 APS + + SYSL GT + RR +F LA Sbjct: 687 APSFQVAFSLMSYSLEGTDSLLPSRRRSLFTLA 719 >03_06_0724 - 35757228-35757323,35757837-35757893,35757983-35758075, 35758271-35758336,35758444-35758653,35758750-35759022, 35759112-35759251,35759330-35759471 Length = 358 Score = 27.9 bits (59), Expect = 8.4 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 3/88 (3%) Frame = +3 Query: 144 VDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGD 323 VD ++ + T V + D + +G A+ + G + + + ++ R E D Sbjct: 134 VDLILEQTTVGTVVKIADDEE-DGEGNGADGSSTGGNDDLFGLISVLNLGRYSEHRCMKD 192 Query: 324 KKSYTLYL---KDYMKKLVAKLEEKAPD 398 K Y L + KD KKL L +KAPD Sbjct: 193 LKDYLLAVCGDKDTKKKLKQMLGDKAPD 220 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,801,428 Number of Sequences: 37544 Number of extensions: 342433 Number of successful extensions: 845 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 840 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -