BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i03 (651 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0144 - 7153464-7153822,7153933-7154837,7155962-7156224 31 0.80 03_06_0565 + 34747278-34748066,34748170-34748406,34749777-347498... 30 1.8 09_04_0598 + 18875270-18875437,18875547-18876179 29 2.4 08_02_1288 + 25902264-25902431,25902506-25903090 28 7.4 04_03_0611 - 18011469-18012563,18012756-18012920,18013542-180136... 27 9.8 >02_02_0144 - 7153464-7153822,7153933-7154837,7155962-7156224 Length = 508 Score = 31.1 bits (67), Expect = 0.80 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +3 Query: 105 LFSTS*SCTS*YRPIRRPERQLLLRRISDCDARSWKSAPTF 227 +F CT P RRP Q +LRR+ C AR W+ P F Sbjct: 469 VFKLGVECTM-MDPQRRPSMQTVLRRLRQC-ARWWRRFPCF 507 >03_06_0565 + 34747278-34748066,34748170-34748406,34749777-34749869, 34751752-34751988,34752398-34752584,34752956-34753028, 34753145-34753289,34753670-34753779,34754127-34754258, 34754328-34754469,34754545-34754679,34756278-34756435, 34757327-34757401,34757505-34757643,34757838-34757952, 34758016-34758107,34758500-34758613 Length = 990 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 199 PDPGSLPLLSQTPSLVVKCDQEGD 270 P+P S P+LS PS++ +C Q D Sbjct: 290 PEPFSRPILSANPSIIARCLQPSD 313 >09_04_0598 + 18875270-18875437,18875547-18876179 Length = 266 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/69 (27%), Positives = 31/69 (44%) Frame = -2 Query: 251 LTTRLGV*ESRGRLPGSGVTVGNPPQEQLPFRSSNGAILTGTTSASRK*LIPTNMRMQMS 72 L T G+ + RL +T N + L +S I+ T A+ L T + +S Sbjct: 36 LRTAAGINSATRRLWAISMTKDNEKKAVLVVQSLRNVIMGSTLVATTAILFCTGIAAVLS 95 Query: 71 QKYTLKEPI 45 YT+K+P+ Sbjct: 96 STYTIKKPL 104 >08_02_1288 + 25902264-25902431,25902506-25903090 Length = 250 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/69 (26%), Positives = 33/69 (47%) Frame = -2 Query: 251 LTTRLGV*ESRGRLPGSGVTVGNPPQEQLPFRSSNGAILTGTTSASRK*LIPTNMRMQMS 72 L++ +G+ + RL G+ N + L +S I+ T A+ L T + +S Sbjct: 36 LSSTVGINTATRRLWVLGMMKDNEKKAVLVVQSMRNVIMGSTLMATTAILFCTGVAAILS 95 Query: 71 QKYTLKEPI 45 YT+K+P+ Sbjct: 96 STYTVKKPL 104 >04_03_0611 - 18011469-18012563,18012756-18012920,18013542-18013639, 18014541-18015498 Length = 771 Score = 27.5 bits (58), Expect = 9.8 Identities = 20/79 (25%), Positives = 34/79 (43%) Frame = +1 Query: 46 MGSLRVYFCDICILMLVGINYFLLAEVVPVSIAPFEDRKGNCSCGGFPTVTPDPGSLPLL 225 + S+ F D L+++ ++ L AE + + A + CGG V P S Sbjct: 9 VASICAAFYDSIWLLVLLLSTALAAETLDGAQAASSQCQNATKCGGVDIVYPFGLSSSGC 68 Query: 226 SQTPSLVVKCDQEGDNTCK 282 + +PS V C+ G+ K Sbjct: 69 AMSPSFEVDCNNTGNGVQK 87 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,906,068 Number of Sequences: 37544 Number of extensions: 318839 Number of successful extensions: 837 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 837 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -