BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10i01 (799 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 23 2.8 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 23 2.8 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 23 2.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.8 DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 22 6.5 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 23.0 bits (47), Expect = 2.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +3 Query: 249 KTEKVTKGGYKAPSLLNDEMFVEAKKRIEDVDIMGDPNSTVSVD 380 KTE +K + SLL+ + E + R+ D D D N TV D Sbjct: 5 KTEIKSKISFSVESLLSKKEDEEVEHRLSDRD-DDDENITVDDD 47 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -3 Query: 341 YIFDT--LLCFDKHLVIEQRGGLVPTFS 264 +IF T LL F HL+ + GGL T+S Sbjct: 127 HIFRTSVLLIFVMHLMFDTLGGLYSTWS 154 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -3 Query: 341 YIFDT--LLCFDKHLVIEQRGGLVPTFS 264 +IF T LL F HL+ + GGL T+S Sbjct: 127 HIFRTSVLLIFVMHLMFDTLGGLYSTWS 154 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 303 EMFVEAKKRIEDVDIMGDPNSTVSVDFKVQ 392 ++ V ++KR D + PN DFK Q Sbjct: 243 DLSVSSRKRSNDDSVSQPPNRKPRTDFKPQ 272 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 21.8 bits (44), Expect = 6.5 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 468 KIDLEAFGRQLKLVLKKQEGLIKKDGLKVWKALKNETQPHGVDYEE 605 K D + K + KK + + ++WK L + P G+ +E+ Sbjct: 67 KSDCAKCSEKQKEMTKKVIHFLSHNKQQMWKELTAKYDPDGIYFEK 112 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,547 Number of Sequences: 336 Number of extensions: 3654 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -