SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte10h23
         (522 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY118726-1|AAM50586.1|  448|Drosophila melanogaster GH02222p pro...    28   8.8  

>AY118726-1|AAM50586.1|  448|Drosophila melanogaster GH02222p
           protein.
          Length = 448

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%)
 Frame = +1

Query: 313 SDAPLTSMDVERALSFAPRRGTAAFKSSGGCSLSWFG-CWGMSATG 447
           SD    S      L+  P R TAA + S  C   W G  W  S  G
Sbjct: 362 SDCDRVSSAPAEILARTPARATAAHRFSAKCLAKWIGTSWWASCPG 407


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,115,279
Number of Sequences: 53049
Number of extensions: 399816
Number of successful extensions: 1534
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1447
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1532
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1929233664
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -