BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h18 (378 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 111 2e-27 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 111 2e-27 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 21 4.8 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 20 8.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 8.4 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 111 bits (268), Expect = 2e-27 Identities = 51/64 (79%), Positives = 59/64 (92%) Frame = +2 Query: 185 MSNLADPVAFAKDFLAGGISAAVSKTAVPPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 364 MS LADPVAFAKDFLAGG++AA+SKT V PIERVKLLLQVQH+SKQI+ +QRYKG++D F Sbjct: 1 MSGLADPVAFAKDFLAGGVAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCF 60 Query: 365 VRIP 376 VRIP Sbjct: 61 VRIP 64 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 111 bits (268), Expect = 2e-27 Identities = 51/64 (79%), Positives = 59/64 (92%) Frame = +2 Query: 185 MSNLADPVAFAKDFLAGGISAAVSKTAVPPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 364 MS LADPVAFAKDFLAGG++AA+SKT V PIERVKLLLQVQH+SKQI+ +QRYKG++D F Sbjct: 1 MSGLADPVAFAKDFLAGGVAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCF 60 Query: 365 VRIP 376 VRIP Sbjct: 61 VRIP 64 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 21.0 bits (42), Expect = 4.8 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +2 Query: 110 VIPHPRVPQLPPRHIHLVKIT 172 +I P +LPP H H +T Sbjct: 92 IITIPPTRKLPPLHPHTAMVT 112 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 20.2 bits (40), Expect = 8.4 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -3 Query: 187 HFVRLCDLH*VNMSRWEL 134 +F+++C ++ VNM+ EL Sbjct: 130 NFIKVCSVNDVNMTITEL 147 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.2 bits (40), Expect = 8.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 308 HVSKQIAADQRYKGIVDAFVRIP 376 ++ K IAA +KG+ RIP Sbjct: 763 YIQKMIAAAAPFKGMETQDYRIP 785 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,804 Number of Sequences: 438 Number of extensions: 1948 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9176370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -