BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h17 (305 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosa... 26 1.4 SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce... 24 5.8 >SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.8 bits (54), Expect = 1.4 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 152 NLSHFYFTLLSFIVEVLYIKFLIQILYTFYHFHFNEVTLLMLI 24 NLS+F TLL + + + I Y +F N + ++M+I Sbjct: 359 NLSNFQLTLLGMGISSFALLGTVIIPYLTEYFQLNSLQVVMII 401 >SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1666 Score = 23.8 bits (49), Expect = 5.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 128 LLSFIVEVLYIKFLIQILYTFYHFHFNEVTL 36 L+ + VE+ + ILYT YH N++ + Sbjct: 1548 LMKYFVEIGNYECFAAILYTCYHLLRNDLVM 1578 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,128,706 Number of Sequences: 5004 Number of extensions: 18316 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 77794588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -