BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h17 (305 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1104 + 24339463-24340314,24340472-24340786 26 6.7 07_03_0139 + 14143383-14143512,14143601-14144334,14144413-141448... 25 8.9 >08_02_1104 + 24339463-24340314,24340472-24340786 Length = 388 Score = 25.8 bits (54), Expect = 6.7 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -1 Query: 299 SPTSKISLYL---RVGEIKWIALDSGRACRC 216 +P + +SL L RV +KW GR CRC Sbjct: 226 TPAAIMSLDLKDNRVAPVKWSPETPGRGCRC 256 >07_03_0139 + 14143383-14143512,14143601-14144334,14144413-14144874, 14144956-14145788,14145871-14146041,14146121-14146379, 14146828-14146866,14147903-14147989 Length = 904 Score = 25.4 bits (53), Expect = 8.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 155 FNLSHFYFTLLSFIVEVLYIKFLIQIL 75 F++ H TLL +VEV YI LI +L Sbjct: 851 FHVCHNMSTLLREVVEVEYIMALIHLL 877 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,596,155 Number of Sequences: 37544 Number of extensions: 100365 Number of successful extensions: 169 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 363831720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -