BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h17 (305 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.0 SB_43551| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.027) 25 9.2 >SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 26.6 bits (56), Expect = 4.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 173 HNGEEFSGCKETINDNDKP 229 H+ F+GC +T+ D+ KP Sbjct: 73 HHQRSFTGCMQTLTDSQKP 91 >SB_43551| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.027) Length = 466 Score = 25.4 bits (53), Expect = 9.2 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -2 Query: 202 FTAAELFAI--VLDDLDFSICPISISRCLVSLL 110 +T L+ I L+ F++C +S++RC S+L Sbjct: 79 YTLLLLYGIHYTLNSQVFAVCVVSVARCFASML 111 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,971,719 Number of Sequences: 59808 Number of extensions: 124450 Number of successful extensions: 275 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 274 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 377252670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -