BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h15 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41058| Best HMM Match : FAT (HMM E-Value=0.0082) 28 4.0 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 >SB_41058| Best HMM Match : FAT (HMM E-Value=0.0082) Length = 628 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 187 SSSSLAGALDCTRSEKKLDIRASIPEVDDQFALAEARCDDLQDKI 321 +S S G L + +DI +SI E+D + + R DL+ +I Sbjct: 299 ASQSTDGGLSTSYQSLLVDIYSSIAELDSVYGVGAGRLADLESRI 343 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 151 DCLKLVKDKRHRSSSSLAGALDCTRSEKKLDIRASIPEVDDQFALAE 291 D +K++KD H +S+ L C++ E L IR + D+ F ++ Sbjct: 3731 DQIKILKDSYHLELASVQADLKCSQMENLLKIRRDMGN-DNSFTASQ 3776 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,536,586 Number of Sequences: 59808 Number of extensions: 214035 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -