BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h14 (673 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 6.1 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 8.1 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 155 KACKF*SQKTSCSCLVKPKCQQRHHLNRPV 244 K C+ T C+ KC +RH RPV Sbjct: 91 KECELSPNSTIAVCVCMRKCPRRH---RPV 117 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 8.1 Identities = 14/55 (25%), Positives = 23/55 (41%) Frame = +1 Query: 289 YEDDEVCVFRDIKPASRFHILTIPKRHIEDVKSLTSADKELLNRMMSISRELLSK 453 + DD ++ P L P I D+K T+ + +LN + S LS+ Sbjct: 407 FVDDVFQEHKNTLPQYTVQQLDFPGIEIADIKLTTNQQRNILNTFWTKSDVDLSR 461 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,836 Number of Sequences: 438 Number of extensions: 3381 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -