BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h12 (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57227| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_24266| Best HMM Match : Transposase_35 (HMM E-Value=1.2) 28 8.3 >SB_57227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 712 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 58 QQNDLNTITEEYKTHITQWGRKKEEYFRRRRSRCSEDPVQ 177 +QNDLN + E YK T++ R+ Y R R S VQ Sbjct: 575 RQNDLNILYETYKMKFTEFERRYPYYSRFRFSANKHGDVQ 614 >SB_24266| Best HMM Match : Transposase_35 (HMM E-Value=1.2) Length = 151 Score = 27.9 bits (59), Expect = 8.3 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +3 Query: 183 RKMVLKHRRMKAFFNNHNPTDYITKGVRKMIGRIYSVSDRVRD-KIAESTMALDNPFSIR 359 RK+ K R ++ F +HN DY+T V+ + RI R+ + K+A T + P+ + Sbjct: 2 RKIAYKLRTLRKFKLSHNLEDYLT-DVKNIDHRIALTKFRLSNHKLAIETGRYEKPYK-K 59 Query: 360 FYEDRCTV 383 E +C V Sbjct: 60 PNERKCLV 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,497,430 Number of Sequences: 59808 Number of extensions: 356909 Number of successful extensions: 944 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 944 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -