BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h12 (693 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81462-2|CAB03841.1| 263|Caenorhabditis elegans Hypothetical pr... 29 3.2 U88310-2|AAB42338.2| 635|Caenorhabditis elegans Hypothetical pr... 29 3.2 >Z81462-2|CAB03841.1| 263|Caenorhabditis elegans Hypothetical protein C04H5.2 protein. Length = 263 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 243 DYITKGVRKMIGRIYSVSDRVRDKIAESTMALDNP 347 D+ITK ++ IG I DR++ +++ ++NP Sbjct: 133 DHITKTIKSTIGAIALAGDRIKQCSTKNSTIIENP 167 >U88310-2|AAB42338.2| 635|Caenorhabditis elegans Hypothetical protein C24G7.2 protein. Length = 635 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 125 FFLPHCVMCVLYSSVIVFRSFCCLNLRFGFYIFHYLK 15 F P+C C + +V+R++ +F FHYLK Sbjct: 434 FQTPNCKACAQQCNSLVYRAYNSYGSQFSAGAFHYLK 470 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,371,622 Number of Sequences: 27780 Number of extensions: 297832 Number of successful extensions: 762 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -