BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h09 (684 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q11WT3 Cluster: DTDP-glucose 4,6 dehydratase; n=1; Cyto... 33 8.6 UniRef50_Q37382 Cluster: NADH-ubiquinone oxidoreductase chain 3;... 33 8.6 >UniRef50_Q11WT3 Cluster: DTDP-glucose 4,6 dehydratase; n=1; Cytophaga hutchinsonii ATCC 33406|Rep: DTDP-glucose 4,6 dehydratase - Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) Length = 301 Score = 32.7 bits (71), Expect = 8.6 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = -3 Query: 187 RDFLLNYFVVFVSMNSNQESLHSCVFRPATAVSRKFNPRWLSVVSTFSMQPMKPGYPW 14 RDF LN VF ++S ++++ SC F ++ + NP L + + P+ P Y W Sbjct: 83 RDFHLNVLNVFNMLDSIRKNIPSCKFVNLSSAAVYGNPESLPIKEDTPINPLSP-YGW 139 >UniRef50_Q37382 Cluster: NADH-ubiquinone oxidoreductase chain 3; n=4; Eukaryota|Rep: NADH-ubiquinone oxidoreductase chain 3 - Acanthamoeba castellanii (Amoeba) Length = 118 Score = 32.7 bits (71), Expect = 8.6 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = -3 Query: 175 LNYFVVFVSMNSNQESLHSCVFRPATAVSRKFNPRWLSVVSTFSMQPMKPGY--PW 14 L+YF+V+ + + S + C F+P KFN R+ + F + ++ Y PW Sbjct: 25 LSYFLVYQESDIEKNSAYECGFQPFEDTRSKFNVRYYLIAILFMIFDLEIMYLFPW 80 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 578,784,885 Number of Sequences: 1657284 Number of extensions: 10040545 Number of successful extensions: 18685 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18683 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -