BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h09 (684 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79600-7|CAI79194.1| 173|Caenorhabditis elegans Hypothetical pr... 29 3.1 Z82073-1|CAB04923.1| 444|Caenorhabditis elegans Hypothetical pr... 28 5.4 >Z79600-7|CAI79194.1| 173|Caenorhabditis elegans Hypothetical protein F59C6.12 protein. Length = 173 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = -3 Query: 448 KYNGNI*CQLFLYILNHNEYLFLNDNR 368 +YNG I + + Y ++HN +LFL+D+R Sbjct: 14 QYNGKI--REYFYYVSHNGFLFLDDSR 38 >Z82073-1|CAB04923.1| 444|Caenorhabditis elegans Hypothetical protein W06D12.2 protein. Length = 444 Score = 28.3 bits (60), Expect = 5.4 Identities = 20/70 (28%), Positives = 34/70 (48%) Frame = +1 Query: 22 IQASSVALRMLRQRTATED*ICETPLWLVETRSYAETPDLSSSKRKLRNN*VKNLYAFIK 201 IQ+ LR + ++ E I +TPL +ET S +P + R + V + F Sbjct: 180 IQSLRQKLRRRKVQSLEEGSIDKTPL--METSSTPPSPQNPNGTRPIPLLLVLIVLFFWM 237 Query: 202 LECIVYFKYY 231 ++C+ YF Y+ Sbjct: 238 IQCVAYFAYF 247 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,445,650 Number of Sequences: 27780 Number of extensions: 241320 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -