BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h03 (795 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23667| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_3454| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) 31 1.4 SB_47082| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_2438| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_46897| Best HMM Match : zf-CCHC (HMM E-Value=0.12) 28 7.6 SB_28743| Best HMM Match : PCI (HMM E-Value=0.00094) 28 7.6 SB_16776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_5252| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_23667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +2 Query: 545 QGQPAQGPCAWEIKQFLECAQQQHDLSLCDGFNEALRQCKVNN 673 QGQ Q PC +E++QF+ECAQ D+++C GFNEALRQCK+ N Sbjct: 108 QGQQ-QNPCQYELQQFVECAQNNSDMNMCQGFNEALRQCKLYN 149 >SB_3454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 325 SSCGSIDPGYDSSSTSAALAIRADGCHGWWR--SCRIGCGSC 444 S C I+P + + S +L C W+ SC +GCGSC Sbjct: 46 SKCLPINPCQNGGTCSESLGTYRCNCMSGWQGLSCEVGCGSC 87 >SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) Length = 1851 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/61 (32%), Positives = 26/61 (42%) Frame = +3 Query: 483 EAASQPSNSKQLLQLKPTINTRDSRLKDHARGRSSNSWNVLNNSTTCHSVMASMKLYVNA 662 E A+Q +K L+ P+IN R L H+ R S N+ T H A LY Sbjct: 1258 EIAAQEEIAKPDLESLPSINDRRQSLGGHSHRRRSTVLNLDTRRGTLHQREAQCLLYFQR 1317 Query: 663 K 665 K Sbjct: 1318 K 1318 >SB_47082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +3 Query: 531 PTINTRDSRLKDHARGRSSNSWNVLNNSTTCHSVMASMKL 650 P I+T D LKD A+GR +NS N L + + A+M L Sbjct: 748 PYIHTPDDSLKDTAKGRENNSINSLPLDISQNREKAAMGL 787 >SB_2438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 452 YQPHDPQPILQLRHQPWQPS 393 Y P P +LRHQPW+PS Sbjct: 1016 YLPEKPAACDRLRHQPWKPS 1035 >SB_46897| Best HMM Match : zf-CCHC (HMM E-Value=0.12) Length = 303 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 545 QGQPAQGP--CAWEIKQFLECAQQQHDLSLCDGFNEALRQCKVNNH 676 + QP GP A + + C +Q+HD LC N+ +C H Sbjct: 213 KSQPKGGPQGSAQGKSKCMFCGKQKHDHQLCPAKNDTCHKCNKRVH 258 >SB_28743| Best HMM Match : PCI (HMM E-Value=0.00094) Length = 322 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/43 (23%), Positives = 25/43 (58%) Frame = +3 Query: 531 PTINTRDSRLKDHARGRSSNSWNVLNNSTTCHSVMASMKLYVN 659 P + + L DH + ++++ +L+ + H+++++ KLY N Sbjct: 175 PELQEFSTMLMDHQKAKTADGSTILDRAVIEHNLLSASKLYNN 217 >SB_16776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1306 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 545 QGQPAQGP--CAWEIKQFLECAQQQHDLSLCDGFNEALRQCKVNNH 676 + QP GP A + + C +Q+HD LC N+ +C H Sbjct: 195 KSQPKGGPQGSAQGKSKCMFCGKQKHDHQLCPAKNDTCHKCNKRVH 240 >SB_5252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 541 Score = 28.3 bits (60), Expect = 7.6 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +1 Query: 244 NHASTRKISKPSTSASKESCSPAK*CTSSCGSIDPGYDSSSTSAALAIRADGC 402 NHA +++ + +SK++C PAK + P Y SST I +GC Sbjct: 233 NHA-LKELWRYLCRSSKKTCDPAKPAKIPFRNTTPSYLLSSTRQQAGIVNEGC 284 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,540,610 Number of Sequences: 59808 Number of extensions: 357234 Number of successful extensions: 2978 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2973 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -