BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h01 (728 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1382 - 29758759-29758806,29758888-29758943,29759901-297600... 29 3.8 09_04_0723 + 19736958-19737107,19737979-19738480,19738911-197390... 28 6.6 01_07_0238 + 42209407-42209964,42210039-42210561,42212577-422126... 28 8.7 01_06_1513 - 37884198-37884485,37884966-37886951,37886976-378873... 28 8.7 >06_03_1382 - 29758759-29758806,29758888-29758943,29759901-29760000, 29760107-29760220,29760807-29760854,29760959-29761021, 29761237-29761439,29761518-29761578,29761685-29761790, 29761920-29761987,29762344-29762418,29762507-29762589, 29762788-29762953 Length = 396 Score = 29.1 bits (62), Expect = 3.8 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 565 DLLYDGFVHRLQTYFLHGGFSG 500 D+L+DG HR++ + LH F G Sbjct: 323 DILFDGQTHRIKKFVLHTNFPG 344 >09_04_0723 + 19736958-19737107,19737979-19738480,19738911-19739061, 19739659-19739766,19739789-19739818,19739894-19740303, 19740797-19740882,19740989-19741058,19741413-19741585, 19741644-19741725,19742131-19742288 Length = 639 Score = 28.3 bits (60), Expect = 6.6 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = -3 Query: 390 SVPKRATPA-GRSSSARNTLLATRRAEYKQRD*RKQYNVQAVSELGHSDTTQSLGARSRR 214 S+PK T G+SSS ++ EY + ++ + + LG SD S +R++R Sbjct: 323 SMPKEETRRNGKSSSHSEIDENSKEQEYNIKGSTQKKIKRDIKVLGSSDKNYSCTSRNKR 382 Query: 213 STSNVDLLRAS 181 S SNV+ R S Sbjct: 383 S-SNVNSKRKS 392 >01_07_0238 + 42209407-42209964,42210039-42210561,42212577-42212665, 42212981-42213191,42213265-42213446,42213573-42213812, 42214691-42214878,42215230-42215323,42215407-42215463, 42215552-42215686,42216460-42216525,42216745-42216858, 42217849-42218010,42218093-42218221,42218323-42218424, 42219428-42219504,42219600-42219957 Length = 1094 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/98 (22%), Positives = 38/98 (38%), Gaps = 2/98 (2%) Frame = -3 Query: 462 PARRSPINKKQLLAASKRSSLRQFSVPKRATPAGRSSSARN--TLLATRRAEYKQRD*RK 289 P+R P KK+ R++ +R+ P+GR+ N + R + K Sbjct: 996 PSRSLPAGKKEFFVKGARNARSPGVKSQRSKPSGRNGDRTNFKSKSEPRPGNGQNTKGDK 1055 Query: 288 QYNVQAVSELGHSDTTQSLGARSRRSTSNVDLLRASAT 175 + G D TQ+ G ++ +S R +AT Sbjct: 1056 PQGFNKRNRTGKFDKTQNRGGKASDRSSRFKKPRTAAT 1093 >01_06_1513 - 37884198-37884485,37884966-37886951,37886976-37887305, 37887397-37887471,37887543-37887734,37887922-37888173, 37888248-37888803,37888881-37889088,37889624-37889736, 37890029-37890060,37890545-37890619 Length = 1368 Score = 27.9 bits (59), Expect = 8.7 Identities = 20/80 (25%), Positives = 38/80 (47%) Frame = -3 Query: 366 AGRSSSARNTLLATRRAEYKQRD*RKQYNVQAVSELGHSDTTQSLGARSRRSTSNVDLLR 187 A SSS +TL ++ ++ + ++ Q+ + T S+G +RS SNV++ Sbjct: 872 ASSSSSEASTLYGRKK---NKKSSGRNFHSQSRETKENPSTQDSMGDSEKRSVSNVEIDT 928 Query: 186 ASATQSKQRQEYGNHEPDAS 127 + T Q + + +PD S Sbjct: 929 NNYTMENQSRN-NDGDPDKS 947 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,408,487 Number of Sequences: 37544 Number of extensions: 413063 Number of successful extensions: 1084 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1084 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -