BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10h01 (728 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 23 2.2 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 23 2.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 5.2 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 22 5.2 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 6.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.0 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.4 bits (48), Expect = 2.2 Identities = 19/78 (24%), Positives = 32/78 (41%) Frame = -3 Query: 324 RRAEYKQRD*RKQYNVQAVSELGHSDTTQSLGARSRRSTSNVDLLRASATQSKQRQEYGN 145 R EYK++D R + +L T++ +RSR N S K+ ++Y Sbjct: 8 RNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQN------SYKNEKEYRKYRE 61 Query: 144 HEPDASVDKTHYSKHGDR 91 + S DK + +R Sbjct: 62 RSKERSRDKRERERSKER 79 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.4 bits (48), Expect = 2.2 Identities = 19/78 (24%), Positives = 32/78 (41%) Frame = -3 Query: 324 RRAEYKQRD*RKQYNVQAVSELGHSDTTQSLGARSRRSTSNVDLLRASATQSKQRQEYGN 145 R EYK++D R + +L T++ +RSR N S K+ ++Y Sbjct: 8 RNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQN------SYKNEKEYRKYRE 61 Query: 144 HEPDASVDKTHYSKHGDR 91 + S DK + +R Sbjct: 62 RSKERSRDKRERERSKER 79 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 246 YQNGQVHSQL 275 Y NGQ HSQL Sbjct: 372 YSNGQTHSQL 381 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 22.2 bits (45), Expect = 5.2 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +3 Query: 468 IGCGSKRITCNPENPPC 518 IGC +++ C+ + PC Sbjct: 91 IGCSAEKFECSKTSNPC 107 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 6.8 Identities = 17/70 (24%), Positives = 30/70 (42%) Frame = -3 Query: 324 RRAEYKQRD*RKQYNVQAVSELGHSDTTQSLGARSRRSTSNVDLLRASATQSKQRQEYGN 145 R EYK++D R + +L T++ +RSR N S ++ ++Y Sbjct: 241 RNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQN------SYKNEREYRKYRE 294 Query: 144 HEPDASVDKT 115 + S D+T Sbjct: 295 RSKERSRDRT 304 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.0 Identities = 20/75 (26%), Positives = 30/75 (40%), Gaps = 3/75 (4%) Frame = +3 Query: 72 CSERRKHGHHVLNNGSCPPMRPARGYRTPVAVWIE*RLHEE-GLHCLSISCSVHQVIGWY 248 CS R K GH +G + P + +P + L E L C + I W Sbjct: 589 CSARNKQGHSARRSGDVAVIVPPK--ISPFTADRDLHLGERTTLTCSVTRGDLPLSISWL 646 Query: 249 QNGQV--HSQLVHYT 287 ++G+ S+ VH T Sbjct: 647 KDGRAMGPSERVHVT 661 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,891 Number of Sequences: 438 Number of extensions: 4703 Number of successful extensions: 25 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -