BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g24 (683 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.44 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.44 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.44 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.44 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 24 1.3 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 1.8 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 2.3 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 3.1 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 5.4 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 7.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 7.1 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 21 7.1 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 9.4 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 9.4 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 21 9.4 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.44 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 330 PAQNEIDIVNARFRNGDPVYKHPMIPGY 413 P + I RNGDP + H IP Y Sbjct: 417 PVSISLLIAACGLRNGDPCFFHDTIPPY 444 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.44 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 330 PAQNEIDIVNARFRNGDPVYKHPMIPGY 413 P + I RNGDP + H IP Y Sbjct: 417 PVSISLLIAACGLRNGDPCFFHDTIPPY 444 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.44 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 330 PAQNEIDIVNARFRNGDPVYKHPMIPGY 413 P + I RNGDP + H IP Y Sbjct: 417 PVSISLLIAACGLRNGDPCFFHDTIPPY 444 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.44 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 330 PAQNEIDIVNARFRNGDPVYKHPMIPGY 413 P + I RNGDP + H IP Y Sbjct: 417 PVSISLLIAACGLRNGDPCFFHDTIPPY 444 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 23.8 bits (49), Expect = 1.3 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 130 NFKKKYFWPNSY 95 + K++Y+WPN Y Sbjct: 151 SMKREYYWPNMY 162 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 606 RAYGRSQWDLWIMEDQV*PHLQEPTQCSAFFGNST 502 + Y R+ WD + Q ++ E + S +F N T Sbjct: 541 QTYLRTAWDKFTNMQQQFAYIDESSNSSNYFANKT 575 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.0 bits (47), Expect = 2.3 Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = +3 Query: 360 ARFRNGDPVYKHPMIPGYEGFSGHVPYGFQRFGESSKKLT--NSALCDFSSNYRR 518 + FR G ++ + + H+ YG+ E + KLT N NYR+ Sbjct: 34 SHFRQGQAKFEITDLEPALQYCTHLIYGYAAIDEETYKLTPLNEQFDVIKDNYRK 88 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 252 GSCVLSSHTYRRSDTCTRDNDPCT 181 G C + YR+ T ++PCT Sbjct: 671 GDCFYENKFYRQEAQWTSSDNPCT 694 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.8 bits (44), Expect = 5.4 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 219 GDTYGSTTHKILLDPSVQHSERLVLSDRTADDFQI 323 GD Y S K LLD H + LV + A I Sbjct: 441 GDRYQSEREKALLDFKTGHRKVLVATGVAARGLDI 475 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 633 HVPGCVFRFGKT 668 H+PGC +GKT Sbjct: 318 HIPGCGKVYGKT 329 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.1 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +3 Query: 456 GESSKKLTNSALCDFSSNYRRRQSTEWAPVNVVKPDPPLSINPTEIY 596 G+ + T+ L +S+ STE A N S NP +IY Sbjct: 155 GKPATSTTSQNLSSPASSTSSTSSTEKAGTNNNNSKSSQSSNPPQIY 201 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 267 VQHSERLVLSDRTADDFQIY 326 V+H L LS++ A DF Y Sbjct: 46 VKHFHPLALSNKNAIDFNYY 65 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +3 Query: 156 IAQPHYIPGYTGHCPEYKY 212 I +Y+ GY G P Y + Sbjct: 372 INHQNYVQGYQGEHPNYNH 390 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 318 QIYRPAQNEIDIVNARFRNGDPVYKHPMIPGY 413 QIY+P N ++ + N D H P Y Sbjct: 348 QIYQPVTNLTNLTYPSYYNQDVSCTHYQNPEY 379 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +3 Query: 156 IAQPHYIPGYTGHCPEYKY 212 I +Y+ GY G P Y + Sbjct: 320 INHQNYVQGYQGEHPNYNH 338 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,709 Number of Sequences: 336 Number of extensions: 4100 Number of successful extensions: 15 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -