BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g24 (683 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0607 + 19168164-19168358,19168594-19168716,19168791-191689... 28 7.9 02_01_0177 + 1214226-1214294,1214707-1214794,1216095-1216308,121... 28 7.9 01_01_0018 + 139150-140415 28 7.9 >10_08_0607 + 19168164-19168358,19168594-19168716,19168791-19168946, 19169129-19169314,19169467-19169583,19169721-19169774, 19169854-19169925,19170430-19170535,19170658-19170754, 19171090-19171184,19172318-19172420,19172699-19172886, 19174928-19175183,19177187-19177325 Length = 628 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +2 Query: 101 IRPKIFFFEIYNGSGFSQYRPTALYSWVHGSLSRVQVSDRRYVWLDNTQDPSRSERAA 274 + P +F +Y G P+ S S R Q++ +WL Q+P+ S R + Sbjct: 383 VYPDVFMTNLYYGGTRIAGDPSNCSSPAAVSTVRKQIASHISLWLSQCQEPTSSRRTS 440 >02_01_0177 + 1214226-1214294,1214707-1214794,1216095-1216308, 1216413-1216738,1216860-1217013,1217377-1217438, 1218078-1218133,1219456-1221279,1221775-1222698, 1222855-1222866 Length = 1242 Score = 27.9 bits (59), Expect = 7.9 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 7/88 (7%) Frame = +3 Query: 336 QNEIDIVNARF---RNGDPVYKHPMIPGYEGFSGHVPYGFQ-RFGESSKKLTN---SALC 494 + EI+I++ F NG PV +PM ++ G G + G SK L +AL Sbjct: 149 EEEINILDENFGAKSNGVPVI-YPMNGHFQNGHGVASNGLDGKAGFVSKSLEGRAVAALN 207 Query: 495 DFSSNYRRRQSTEWAPVNVVKPDPPLSI 578 F N + W + PDPP + Sbjct: 208 KFGQNAKMTSDPMWMKKALPPPDPPAMV 235 >01_01_0018 + 139150-140415 Length = 421 Score = 27.9 bits (59), Expect = 7.9 Identities = 24/87 (27%), Positives = 36/87 (41%), Gaps = 4/87 (4%) Frame = +1 Query: 142 WI*SVSPNRIIFLGTRV---IVPSTSIGSAIRMARQHTRSFSIRACS-IQRGWCYPIERP 309 W + S NR I L T + I + S + + H CS + C +++P Sbjct: 86 WASAQSHNRCIILDTDIAEAIASTESYDFLVDILHNHREKHKSTPCSTLTTKRCRLVDQP 145 Query: 310 MTSRSTVQHRTR*TS*THVSVMAIPFT 390 TSR QH+ + T+ AIP T Sbjct: 146 STSRPPYQHQLPLFAPTYTP--AIPIT 170 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,808,536 Number of Sequences: 37544 Number of extensions: 454132 Number of successful extensions: 1153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1153 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -