BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g23 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) 54 1e-07 SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_18720| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 4.7 SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_53793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_45652| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) Length = 80 Score = 54.0 bits (124), Expect = 1e-07 Identities = 28/71 (39%), Positives = 43/71 (60%) Frame = +3 Query: 198 IAEKVSGTVKWFNVKSGYGFINRNDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVV 377 ++ + +GTVKWFN + GYGFI + +D+FVH AI + +S+ +G+AV F Sbjct: 12 MSNRQNGTVKWFNDEKGYGFIT-PQSGDDLFVHFKAIQSD----GFKSLKEGQAVTFVAT 66 Query: 378 AGEKGFEAAGV 410 G+KG +A V Sbjct: 67 RGQKGMQAEEV 77 >SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +3 Query: 387 KGFEAAGVTGPGGEPVKGSPYAADKRRGYHR 479 +G EA+ VTGP GEPV+GS YA D+RR +R Sbjct: 13 QGLEASNVTGPDGEPVQGSKYAPDRRRRNNR 43 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +3 Query: 309 ARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG-EPVKGSPYAADKRRG 470 AR +AVR GE +V G G G G GG E V+G+PY ++ G Sbjct: 395 AREYLARAVREGLRGEEGSPSVFLGGGGRGGGGGDGGGGGEGVQGTPYTPEEEEG 449 >SB_18720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 28.7 bits (61), Expect = 4.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 626 FFPSQFSRWTPWGRSW 673 +FPS F+ W+PW +W Sbjct: 3 WFPSSFNSWSPWTWNW 18 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -3 Query: 111 RYQPWCNWRTAMVAKMVKYSTTSPRCS-PLFVVTSDKL 1 R+ PW +WR+A ++ Y + RC+ P+ ++T +L Sbjct: 1887 RFHPW-SWRSAPAVRLELYGCLTDRCTMPMGLMTDRRL 1923 >SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 Query: 428 ASKRLTLCCRQAPWLPP 478 AS T+C RQAPWL P Sbjct: 19 ASPTWTICLRQAPWLSP 35 >SB_53793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 201 AEKVSGTVKWFNVKSGYGFINRNDTKEDVFVH 296 AEK G V ++K +GFI R D ++F H Sbjct: 201 AEKYQGVVS--SMKESFGFIERADKVSEIFFH 230 >SB_45652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +3 Query: 198 IAEKVSGTVKWFNVKSGYGFINRNDTKEDVFVHQTAIARNNPRKAVRSVGD 350 +A+ + + VKSGY + DTK +V Q A P+ R+ GD Sbjct: 60 MADGYTAFFSFSRVKSGYSVFSGKDTKAEVPSLQAAQHLPEPKGRKRTTGD 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,053,263 Number of Sequences: 59808 Number of extensions: 282899 Number of successful extensions: 869 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -